data_1QQQ # _entry.id 1QQQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.357 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1QQQ pdb_00001qqq 10.2210/pdb1qqq/pdb RCSB RCSB009155 ? ? WWPDB D_1000009155 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1QQQ _pdbx_database_status.recvd_initial_deposition_date 1999-06-07 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Fantz, C.' 1 ? 'Shaw, D.' 2 ? 'Jennings, W.' 3 ? 'Forsthoefel, A.' 4 ? 'Kitchens, M.' 5 ? 'Phan, J.' 6 ? 'Minor, W.' 7 0000-0001-7075-7090 'Lebioda, L.' 8 ? 'Berger, F.G.' 9 ? 'Spencer, H.T.' 10 ? # _citation.id primary _citation.title 'Drug-resistant variants of Escherichia coli thymidylate synthase: effects of substitutions at Pro-254.' _citation.journal_abbrev Mol.Pharmacol. _citation.journal_volume 57 _citation.page_first 359 _citation.page_last 366 _citation.year 2000 _citation.journal_id_ASTM MOPMA3 _citation.country US _citation.journal_id_ISSN 0026-895X _citation.journal_id_CSD 0197 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10648646 _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fantz, C.' 1 ? primary 'Shaw, D.' 2 ? primary 'Jennings, W.' 3 ? primary 'Forsthoefel, A.' 4 ? primary 'Kitchens, M.' 5 ? primary 'Phan, J.' 6 ? primary 'Minor, W.' 7 0000-0001-7075-7090 primary 'Lebioda, L.' 8 ? primary 'Berger, F.G.' 9 ? primary 'Spencer, H.T.' 10 ? # _cell.entry_id 1QQQ _cell.length_a 132.437 _cell.length_b 132.437 _cell.length_c 132.437 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1QQQ _symmetry.space_group_name_H-M 'I 21 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting cubic _symmetry.Int_Tables_number 199 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'THYMIDYLATE SYNTHASE' 30854.096 1 2.1.1.45 P254S ? ? 2 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 3 water nat water 18.015 221 ? ? ? ? # _entity_name_sys.entity_id 1 _entity_name_sys.name 'E.C. 2.1.1.45' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(CXM)KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKR(CME)HLRSIIHELLWFLQGDTNIAYL HENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAP(CME)HA FFQFYVADGKLSCQLYQRS(CME)DVFLGLPFNIASYALLVHMMAQQ(CME)DLEVGDFVWTGGDTHLYSNHMDQTHLQL SREPRPLPKLIIKRKPESIFDYRFEDFEIEGYDSHPGIKAPVAI ; _entity_poly.pdbx_seq_one_letter_code_can ;MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIW DEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLS CQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF DYRFEDFEIEGYDSHPGIKAPVAI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CXM n 1 2 LYS n 1 3 GLN n 1 4 TYR n 1 5 LEU n 1 6 GLU n 1 7 LEU n 1 8 MET n 1 9 GLN n 1 10 LYS n 1 11 VAL n 1 12 LEU n 1 13 ASP n 1 14 GLU n 1 15 GLY n 1 16 THR n 1 17 GLN n 1 18 LYS n 1 19 ASN n 1 20 ASP n 1 21 ARG n 1 22 THR n 1 23 GLY n 1 24 THR n 1 25 GLY n 1 26 THR n 1 27 LEU n 1 28 SER n 1 29 ILE n 1 30 PHE n 1 31 GLY n 1 32 HIS n 1 33 GLN n 1 34 MET n 1 35 ARG n 1 36 PHE n 1 37 ASN n 1 38 LEU n 1 39 GLN n 1 40 ASP n 1 41 GLY n 1 42 PHE n 1 43 PRO n 1 44 LEU n 1 45 VAL n 1 46 THR n 1 47 THR n 1 48 LYS n 1 49 ARG n 1 50 CME n 1 51 HIS n 1 52 LEU n 1 53 ARG n 1 54 SER n 1 55 ILE n 1 56 ILE n 1 57 HIS n 1 58 GLU n 1 59 LEU n 1 60 LEU n 1 61 TRP n 1 62 PHE n 1 63 LEU n 1 64 GLN n 1 65 GLY n 1 66 ASP n 1 67 THR n 1 68 ASN n 1 69 ILE n 1 70 ALA n 1 71 TYR n 1 72 LEU n 1 73 HIS n 1 74 GLU n 1 75 ASN n 1 76 ASN n 1 77 VAL n 1 78 THR n 1 79 ILE n 1 80 TRP n 1 81 ASP n 1 82 GLU n 1 83 TRP n 1 84 ALA n 1 85 ASP n 1 86 GLU n 1 87 ASN n 1 88 GLY n 1 89 ASP n 1 90 LEU n 1 91 GLY n 1 92 PRO n 1 93 VAL n 1 94 TYR n 1 95 GLY n 1 96 LYS n 1 97 GLN n 1 98 TRP n 1 99 ARG n 1 100 ALA n 1 101 TRP n 1 102 PRO n 1 103 THR n 1 104 PRO n 1 105 ASP n 1 106 GLY n 1 107 ARG n 1 108 HIS n 1 109 ILE n 1 110 ASP n 1 111 GLN n 1 112 ILE n 1 113 THR n 1 114 THR n 1 115 VAL n 1 116 LEU n 1 117 ASN n 1 118 GLN n 1 119 LEU n 1 120 LYS n 1 121 ASN n 1 122 ASP n 1 123 PRO n 1 124 ASP n 1 125 SER n 1 126 ARG n 1 127 ARG n 1 128 ILE n 1 129 ILE n 1 130 VAL n 1 131 SER n 1 132 ALA n 1 133 TRP n 1 134 ASN n 1 135 VAL n 1 136 GLY n 1 137 GLU n 1 138 LEU n 1 139 ASP n 1 140 LYS n 1 141 MET n 1 142 ALA n 1 143 LEU n 1 144 ALA n 1 145 PRO n 1 146 CME n 1 147 HIS n 1 148 ALA n 1 149 PHE n 1 150 PHE n 1 151 GLN n 1 152 PHE n 1 153 TYR n 1 154 VAL n 1 155 ALA n 1 156 ASP n 1 157 GLY n 1 158 LYS n 1 159 LEU n 1 160 SER n 1 161 CYS n 1 162 GLN n 1 163 LEU n 1 164 TYR n 1 165 GLN n 1 166 ARG n 1 167 SER n 1 168 CME n 1 169 ASP n 1 170 VAL n 1 171 PHE n 1 172 LEU n 1 173 GLY n 1 174 LEU n 1 175 PRO n 1 176 PHE n 1 177 ASN n 1 178 ILE n 1 179 ALA n 1 180 SER n 1 181 TYR n 1 182 ALA n 1 183 LEU n 1 184 LEU n 1 185 VAL n 1 186 HIS n 1 187 MET n 1 188 MET n 1 189 ALA n 1 190 GLN n 1 191 GLN n 1 192 CME n 1 193 ASP n 1 194 LEU n 1 195 GLU n 1 196 VAL n 1 197 GLY n 1 198 ASP n 1 199 PHE n 1 200 VAL n 1 201 TRP n 1 202 THR n 1 203 GLY n 1 204 GLY n 1 205 ASP n 1 206 THR n 1 207 HIS n 1 208 LEU n 1 209 TYR n 1 210 SER n 1 211 ASN n 1 212 HIS n 1 213 MET n 1 214 ASP n 1 215 GLN n 1 216 THR n 1 217 HIS n 1 218 LEU n 1 219 GLN n 1 220 LEU n 1 221 SER n 1 222 ARG n 1 223 GLU n 1 224 PRO n 1 225 ARG n 1 226 PRO n 1 227 LEU n 1 228 PRO n 1 229 LYS n 1 230 LEU n 1 231 ILE n 1 232 ILE n 1 233 LYS n 1 234 ARG n 1 235 LYS n 1 236 PRO n 1 237 GLU n 1 238 SER n 1 239 ILE n 1 240 PHE n 1 241 ASP n 1 242 TYR n 1 243 ARG n 1 244 PHE n 1 245 GLU n 1 246 ASP n 1 247 PHE n 1 248 GLU n 1 249 ILE n 1 250 GLU n 1 251 GLY n 1 252 TYR n 1 253 ASP n 1 254 SER n 1 255 HIS n 1 256 PRO n 1 257 GLY n 1 258 ILE n 1 259 LYS n 1 260 ALA n 1 261 PRO n 1 262 VAL n 1 263 ALA n 1 264 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain X2913 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector 'PBLUESCRIPT SK' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TYSY_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P0A884 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1QQQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 264 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A884 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 264 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 264 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1QQQ _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 254 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P0A884 _struct_ref_seq_dif.db_mon_id PHE _struct_ref_seq_dif.pdbx_seq_db_seq_num 254 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 254 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CME 'L-peptide linking' n 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' ? 'C5 H11 N O3 S2' 197.276 CXM 'L-peptide linking' n N-CARBOXYMETHIONINE ? 'C6 H11 N O4 S' 193.221 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1QQQ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.14 _exptl_crystal.density_percent_sol 60.77 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.8 _exptl_crystal_grow.pdbx_details '58% SATURATED AMMONIUM SULFATE, 20 MM 2-MERCAPTOETHANOL, 100 MM TRIS HCL, pH 8.8, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 138.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type APS-1 _diffrn_detector.pdbx_collection_date 1999-02-22 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9793 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_wavelength 0.9793 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1QQQ _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F 3.0 _reflns.d_resolution_low 6 _reflns.d_resolution_high 1.5 _reflns.number_obs 515160 _reflns.number_all 515931 _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.0660000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 15.4 _reflns.B_iso_Wilson_estimate 20.7 _reflns.pdbx_redundancy 6.8 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.50 _reflns_shell.d_res_low 1.55 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.3000000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 8.4 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1QQQ _refine.ls_number_reflns_obs 56395 _refine.ls_number_reflns_all 56424 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 3.0 _refine.pdbx_data_cutoff_high_absF 2800394.09 _refine.pdbx_data_cutoff_low_absF 0.00 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 6.00 _refine.ls_d_res_high 1.50 _refine.ls_percent_reflns_obs 92.9 _refine.ls_R_factor_obs 0.2240000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2240000 _refine.ls_R_factor_R_free 0.2380000 _refine.ls_R_factor_R_free_error 0.006 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 3.0 _refine.ls_number_reflns_R_free 1713 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 24.8 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'USED MAXIMUM LIKELIHOOD ON F' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'ENGH & HUBER' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1QQQ _refine_analyze.Luzzati_coordinate_error_obs 0.20 _refine_analyze.Luzzati_sigma_a_obs 0.13 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.21 _refine_analyze.Luzzati_sigma_a_free 0.14 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2163 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.number_atoms_solvent 221 _refine_hist.number_atoms_total 2399 _refine_hist.d_res_high 1.50 _refine_hist.d_res_low 6.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.005 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.5 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 24.0 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.81 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 0.90 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 1.55 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 1.51 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 2.08 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 1.50 _refine_ls_shell.d_res_low 1.59 _refine_ls_shell.number_reflns_R_work 8055 _refine_ls_shell.R_factor_R_work 0.2540000 _refine_ls_shell.percent_reflns_obs 82.2 _refine_ls_shell.R_factor_R_free 0.2380000 _refine_ls_shell.R_factor_R_free_error 0.016 _refine_ls_shell.percent_reflns_R_free 2.8 _refine_ls_shell.number_reflns_R_free 232 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PA PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARA WATER.TOP 'X-RAY DIFFRACTION' 3 ION.PARAM ION.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 1QQQ _struct.title 'CRYSTAL STRUCTURE ANALYSIS OF SER254 MUTANT OF ESCHERICHIA COLI THYMIDYLATE SYNTHASE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1QQQ _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'THYMIDYLATE SYNTHASE, METHYLTRANSFERASE, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 2 ? GLY A 15 ? LYS A 2 GLY A 15 1 ? 14 HELX_P HELX_P2 2 GLN A 39 ? GLY A 41 ? GLN A 39 GLY A 41 5 ? 3 HELX_P HELX_P3 3 LEU A 52 ? GLY A 65 ? LEU A 52 GLY A 65 1 ? 14 HELX_P HELX_P4 4 ILE A 69 ? ASN A 75 ? ILE A 69 ASN A 75 1 ? 7 HELX_P HELX_P5 5 VAL A 93 ? ALA A 100 ? VAL A 93 ALA A 100 1 ? 8 HELX_P HELX_P6 6 ASP A 110 ? ASP A 122 ? ASP A 110 ASP A 122 1 ? 13 HELX_P HELX_P7 7 ASN A 134 ? MET A 141 ? ASN A 134 MET A 141 5 ? 8 HELX_P HELX_P8 8 GLY A 173 ? GLN A 191 ? GLY A 173 GLN A 191 1 ? 19 HELX_P HELX_P9 9 HIS A 212 ? SER A 221 ? HIS A 212 SER A 221 1 ? 10 HELX_P HELX_P10 10 ARG A 243 ? GLU A 245 ? ARG A 243 GLU A 245 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A CXM 1 C ? ? ? 1_555 A LYS 2 N ? ? A CXM 1 A LYS 2 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale2 covale both ? A ARG 49 C ? ? ? 1_555 A CME 50 N ? ? A ARG 49 A CME 50 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale3 covale both ? A CME 50 C ? ? ? 1_555 A HIS 51 N ? ? A CME 50 A HIS 51 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale4 covale both ? A PRO 145 C ? ? ? 1_555 A CME 146 N ? ? A PRO 145 A CME 146 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale5 covale both ? A CME 146 C ? ? ? 1_555 A HIS 147 N ? ? A CME 146 A HIS 147 1_555 ? ? ? ? ? ? ? 1.338 ? ? covale6 covale both ? A SER 167 C ? ? ? 1_555 A CME 168 N ? ? A SER 167 A CME 168 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale7 covale both ? A CME 168 C ? ? ? 1_555 A ASP 169 N ? ? A CME 168 A ASP 169 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale8 covale both ? A GLN 191 C ? ? ? 1_555 A CME 192 N ? ? A GLN 191 A CME 192 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale9 covale both ? A CME 192 C ? ? ? 1_555 A ASP 193 N ? ? A CME 192 A ASP 193 1_555 ? ? ? ? ? ? ? 1.327 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 16 ? ASN A 19 ? THR A 16 ASN A 19 A 2 GLY A 25 ? ASN A 37 ? GLY A 25 ASN A 37 A 3 GLU A 195 ? TYR A 209 ? GLU A 195 TYR A 209 A 4 LYS A 158 ? GLN A 165 ? LYS A 158 GLN A 165 A 5 PHE A 149 ? ALA A 155 ? PHE A 149 ALA A 155 A 6 ILE A 129 ? SER A 131 ? ILE A 129 SER A 131 B 1 TRP A 101 ? PRO A 102 ? TRP A 101 PRO A 102 B 2 HIS A 108 ? ILE A 109 ? HIS A 108 ILE A 109 C 1 LYS A 229 ? ILE A 232 ? LYS A 229 ILE A 232 C 2 PHE A 247 ? GLU A 250 ? PHE A 247 GLU A 250 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 18 ? N LYS A 18 O THR A 26 ? O THR A 26 A 2 3 O PHE A 36 ? O PHE A 36 N PHE A 199 ? N PHE A 199 A 3 4 N GLY A 197 ? N GLY A 197 O LEU A 159 ? O LEU A 159 A 4 5 N TYR A 164 ? N TYR A 164 O PHE A 149 ? O PHE A 149 A 5 6 O PHE A 150 ? O PHE A 150 N VAL A 130 ? N VAL A 130 B 1 2 O TRP A 101 ? O TRP A 101 N ILE A 109 ? N ILE A 109 C 1 2 N ILE A 231 ? N ILE A 231 O GLU A 248 ? O GLU A 248 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 320 ? 3 'BINDING SITE FOR RESIDUE SO4 A 320' AC2 Software A SO4 321 ? 7 'BINDING SITE FOR RESIDUE SO4 A 321' AC3 Software A SO4 322 ? 7 'BINDING SITE FOR RESIDUE SO4 A 322' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ARG A 225 ? ARG A 225 . ? 1_555 ? 2 AC1 3 HIS A 255 ? HIS A 255 . ? 1_555 ? 3 AC1 3 HOH E . ? HOH A 410 . ? 1_555 ? 4 AC2 7 ARG A 21 ? ARG A 21 . ? 1_555 ? 5 AC2 7 ARG A 126 ? ARG A 126 . ? 14_555 ? 6 AC2 7 ARG A 127 ? ARG A 127 . ? 14_555 ? 7 AC2 7 ARG A 166 ? ARG A 166 . ? 1_555 ? 8 AC2 7 HOH E . ? HOH A 373 . ? 14_555 ? 9 AC2 7 HOH E . ? HOH A 536 . ? 1_555 ? 10 AC2 7 HOH E . ? HOH A 539 . ? 1_555 ? 11 AC3 7 HIS A 51 ? HIS A 51 . ? 1_555 ? 12 AC3 7 ARG A 53 ? ARG A 53 . ? 1_555 ? 13 AC3 7 SER A 54 ? SER A 54 . ? 1_555 ? 14 AC3 7 HOH E . ? HOH A 394 . ? 1_555 ? 15 AC3 7 HOH E . ? HOH A 397 . ? 1_555 ? 16 AC3 7 HOH E . ? HOH A 398 . ? 15_556 ? 17 AC3 7 HOH E . ? HOH A 492 . ? 15_556 ? # _database_PDB_matrix.entry_id 1QQQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1QQQ _atom_sites.fract_transf_matrix[1][1] 0.007551 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007551 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007551 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CXM 1 1 1 CXM CXM A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 GLN 17 17 17 GLN GLU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 CME 50 50 50 CME CME A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 TRP 61 61 61 TRP TRP A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 TRP 80 80 80 TRP TRP A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 TRP 83 83 83 TRP TRP A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 TRP 98 98 98 TRP TRP A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 TRP 101 101 101 TRP TRP A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 TRP 133 133 133 TRP TRP A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 MET 141 141 141 MET MET A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 CME 146 146 146 CME CME A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 PHE 149 149 149 PHE PHE A . n A 1 150 PHE 150 150 150 PHE PHE A . n A 1 151 GLN 151 151 151 GLN GLN A . n A 1 152 PHE 152 152 152 PHE PHE A . n A 1 153 TYR 153 153 153 TYR TYR A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 SER 160 160 160 SER SER A . n A 1 161 CYS 161 161 161 CYS CYS A . n A 1 162 GLN 162 162 162 GLN GLN A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 TYR 164 164 164 TYR TYR A . n A 1 165 GLN 165 165 165 GLN GLN A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 SER 167 167 167 SER SER A . n A 1 168 CME 168 168 168 CME CME A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 PHE 171 171 171 PHE PHE A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 ASN 177 177 177 ASN ASN A . n A 1 178 ILE 178 178 178 ILE ILE A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 SER 180 180 180 SER SER A . n A 1 181 TYR 181 181 181 TYR TYR A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 HIS 186 186 186 HIS HIS A . n A 1 187 MET 187 187 187 MET MET A . n A 1 188 MET 188 188 188 MET MET A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 GLN 190 190 190 GLN GLN A . n A 1 191 GLN 191 191 191 GLN GLN A . n A 1 192 CME 192 192 192 CME CME A . n A 1 193 ASP 193 193 193 ASP ASP A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 GLU 195 195 195 GLU GLU A . n A 1 196 VAL 196 196 196 VAL VAL A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 ASP 198 198 198 ASP ASP A . n A 1 199 PHE 199 199 199 PHE PHE A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 TRP 201 201 201 TRP TRP A . n A 1 202 THR 202 202 202 THR THR A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 GLY 204 204 204 GLY GLY A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 THR 206 206 206 THR THR A . n A 1 207 HIS 207 207 207 HIS HIS A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 TYR 209 209 209 TYR TYR A . n A 1 210 SER 210 210 210 SER SER A . n A 1 211 ASN 211 211 211 ASN ASN A . n A 1 212 HIS 212 212 212 HIS HIS A . n A 1 213 MET 213 213 213 MET MET A . n A 1 214 ASP 214 214 214 ASP ASP A . n A 1 215 GLN 215 215 215 GLN GLN A . n A 1 216 THR 216 216 216 THR THR A . n A 1 217 HIS 217 217 217 HIS HIS A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 GLN 219 219 219 GLN GLN A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 SER 221 221 221 SER SER A . n A 1 222 ARG 222 222 222 ARG ARG A . n A 1 223 GLU 223 223 223 GLU GLU A . n A 1 224 PRO 224 224 224 PRO PRO A . n A 1 225 ARG 225 225 225 ARG ARG A . n A 1 226 PRO 226 226 226 PRO PRO A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 PRO 228 228 228 PRO PRO A . n A 1 229 LYS 229 229 229 LYS LYS A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 ILE 231 231 231 ILE ILE A . n A 1 232 ILE 232 232 232 ILE ILE A . n A 1 233 LYS 233 233 233 LYS LYS A . n A 1 234 ARG 234 234 234 ARG ARG A . n A 1 235 LYS 235 235 235 LYS LYS A . n A 1 236 PRO 236 236 236 PRO PRO A . n A 1 237 GLU 237 237 237 GLU GLU A . n A 1 238 SER 238 238 238 SER SER A . n A 1 239 ILE 239 239 239 ILE ILE A . n A 1 240 PHE 240 240 240 PHE PHE A . n A 1 241 ASP 241 241 241 ASP ASP A . n A 1 242 TYR 242 242 242 TYR TYR A . n A 1 243 ARG 243 243 243 ARG ARG A . n A 1 244 PHE 244 244 244 PHE PHE A . n A 1 245 GLU 245 245 245 GLU GLU A . n A 1 246 ASP 246 246 246 ASP ASP A . n A 1 247 PHE 247 247 247 PHE PHE A . n A 1 248 GLU 248 248 248 GLU GLU A . n A 1 249 ILE 249 249 249 ILE ILE A . n A 1 250 GLU 250 250 250 GLU GLU A . n A 1 251 GLY 251 251 251 GLY GLY A . n A 1 252 TYR 252 252 252 TYR TYR A . n A 1 253 ASP 253 253 253 ASP ASP A . n A 1 254 SER 254 254 254 SER SER A . n A 1 255 HIS 255 255 255 HIS HIS A . n A 1 256 PRO 256 256 256 PRO PRO A . n A 1 257 GLY 257 257 257 GLY GLY A . n A 1 258 ILE 258 258 258 ILE ILE A . n A 1 259 LYS 259 259 259 LYS LYS A . n A 1 260 ALA 260 260 260 ALA ALA A . n A 1 261 PRO 261 261 261 PRO PRO A . n A 1 262 VAL 262 262 262 VAL VAL A . n A 1 263 ALA 263 263 263 ALA ALA A . n A 1 264 ILE 264 264 264 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 320 320 SO4 SO4 A . C 2 SO4 1 321 321 SO4 SO4 A . D 2 SO4 1 322 322 SO4 SO4 A . E 3 HOH 1 323 1 HOH HOH A . E 3 HOH 2 324 2 HOH HOH A . E 3 HOH 3 325 3 HOH HOH A . E 3 HOH 4 326 4 HOH HOH A . E 3 HOH 5 327 5 HOH HOH A . E 3 HOH 6 328 6 HOH HOH A . E 3 HOH 7 329 7 HOH HOH A . E 3 HOH 8 330 8 HOH HOH A . E 3 HOH 9 331 9 HOH HOH A . E 3 HOH 10 332 10 HOH HOH A . E 3 HOH 11 333 11 HOH HOH A . E 3 HOH 12 334 12 HOH HOH A . E 3 HOH 13 335 13 HOH HOH A . E 3 HOH 14 336 14 HOH HOH A . E 3 HOH 15 337 15 HOH HOH A . E 3 HOH 16 338 16 HOH HOH A . E 3 HOH 17 339 17 HOH HOH A . E 3 HOH 18 340 18 HOH HOH A . E 3 HOH 19 341 19 HOH HOH A . E 3 HOH 20 342 20 HOH HOH A . E 3 HOH 21 343 21 HOH HOH A . E 3 HOH 22 344 22 HOH HOH A . E 3 HOH 23 345 23 HOH HOH A . E 3 HOH 24 346 24 HOH HOH A . E 3 HOH 25 347 25 HOH HOH A . E 3 HOH 26 348 26 HOH HOH A . E 3 HOH 27 349 27 HOH HOH A . E 3 HOH 28 350 28 HOH HOH A . E 3 HOH 29 351 29 HOH HOH A . E 3 HOH 30 352 30 HOH HOH A . E 3 HOH 31 353 31 HOH HOH A . E 3 HOH 32 354 32 HOH HOH A . E 3 HOH 33 355 33 HOH HOH A . E 3 HOH 34 356 34 HOH HOH A . E 3 HOH 35 357 35 HOH HOH A . E 3 HOH 36 358 36 HOH HOH A . E 3 HOH 37 359 37 HOH HOH A . E 3 HOH 38 360 38 HOH HOH A . E 3 HOH 39 361 39 HOH HOH A . E 3 HOH 40 362 40 HOH HOH A . E 3 HOH 41 363 41 HOH HOH A . E 3 HOH 42 364 42 HOH HOH A . E 3 HOH 43 365 43 HOH HOH A . E 3 HOH 44 366 44 HOH HOH A . E 3 HOH 45 367 45 HOH HOH A . E 3 HOH 46 368 46 HOH HOH A . E 3 HOH 47 369 47 HOH HOH A . E 3 HOH 48 370 48 HOH HOH A . E 3 HOH 49 371 49 HOH HOH A . E 3 HOH 50 372 50 HOH HOH A . E 3 HOH 51 373 51 HOH HOH A . E 3 HOH 52 374 52 HOH HOH A . E 3 HOH 53 375 53 HOH HOH A . E 3 HOH 54 376 54 HOH HOH A . E 3 HOH 55 377 55 HOH HOH A . E 3 HOH 56 378 56 HOH HOH A . E 3 HOH 57 379 57 HOH HOH A . E 3 HOH 58 380 58 HOH HOH A . E 3 HOH 59 381 59 HOH HOH A . E 3 HOH 60 382 60 HOH HOH A . E 3 HOH 61 383 61 HOH HOH A . E 3 HOH 62 384 62 HOH HOH A . E 3 HOH 63 385 63 HOH HOH A . E 3 HOH 64 386 64 HOH HOH A . E 3 HOH 65 387 65 HOH HOH A . E 3 HOH 66 388 66 HOH HOH A . E 3 HOH 67 389 67 HOH HOH A . E 3 HOH 68 390 68 HOH HOH A . E 3 HOH 69 391 69 HOH HOH A . E 3 HOH 70 392 70 HOH HOH A . E 3 HOH 71 393 71 HOH HOH A . E 3 HOH 72 394 72 HOH HOH A . E 3 HOH 73 395 73 HOH HOH A . E 3 HOH 74 396 74 HOH HOH A . E 3 HOH 75 397 75 HOH HOH A . E 3 HOH 76 398 76 HOH HOH A . E 3 HOH 77 399 77 HOH HOH A . E 3 HOH 78 400 78 HOH HOH A . E 3 HOH 79 401 79 HOH HOH A . E 3 HOH 80 402 80 HOH HOH A . E 3 HOH 81 403 81 HOH HOH A . E 3 HOH 82 404 82 HOH HOH A . E 3 HOH 83 405 83 HOH HOH A . E 3 HOH 84 406 84 HOH HOH A . E 3 HOH 85 407 85 HOH HOH A . E 3 HOH 86 408 86 HOH HOH A . E 3 HOH 87 409 87 HOH HOH A . E 3 HOH 88 410 88 HOH HOH A . E 3 HOH 89 411 89 HOH HOH A . E 3 HOH 90 412 90 HOH HOH A . E 3 HOH 91 413 91 HOH HOH A . E 3 HOH 92 414 92 HOH HOH A . E 3 HOH 93 415 93 HOH HOH A . E 3 HOH 94 416 94 HOH HOH A . E 3 HOH 95 417 95 HOH HOH A . E 3 HOH 96 418 96 HOH HOH A . E 3 HOH 97 419 97 HOH HOH A . E 3 HOH 98 420 98 HOH HOH A . E 3 HOH 99 421 99 HOH HOH A . E 3 HOH 100 422 100 HOH HOH A . E 3 HOH 101 423 101 HOH HOH A . E 3 HOH 102 424 102 HOH HOH A . E 3 HOH 103 425 103 HOH HOH A . E 3 HOH 104 426 104 HOH HOH A . E 3 HOH 105 427 105 HOH HOH A . E 3 HOH 106 428 106 HOH HOH A . E 3 HOH 107 429 107 HOH HOH A . E 3 HOH 108 430 108 HOH HOH A . E 3 HOH 109 431 109 HOH HOH A . E 3 HOH 110 432 110 HOH HOH A . E 3 HOH 111 433 111 HOH HOH A . E 3 HOH 112 434 112 HOH HOH A . E 3 HOH 113 435 113 HOH HOH A . E 3 HOH 114 436 114 HOH HOH A . E 3 HOH 115 437 115 HOH HOH A . E 3 HOH 116 438 116 HOH HOH A . E 3 HOH 117 439 117 HOH HOH A . E 3 HOH 118 440 118 HOH HOH A . E 3 HOH 119 441 119 HOH HOH A . E 3 HOH 120 442 120 HOH HOH A . E 3 HOH 121 443 121 HOH HOH A . E 3 HOH 122 444 122 HOH HOH A . E 3 HOH 123 445 123 HOH HOH A . E 3 HOH 124 446 124 HOH HOH A . E 3 HOH 125 447 125 HOH HOH A . E 3 HOH 126 448 126 HOH HOH A . E 3 HOH 127 449 127 HOH HOH A . E 3 HOH 128 450 128 HOH HOH A . E 3 HOH 129 451 129 HOH HOH A . E 3 HOH 130 452 130 HOH HOH A . E 3 HOH 131 453 131 HOH HOH A . E 3 HOH 132 454 132 HOH HOH A . E 3 HOH 133 455 133 HOH HOH A . E 3 HOH 134 456 134 HOH HOH A . E 3 HOH 135 457 135 HOH HOH A . E 3 HOH 136 458 136 HOH HOH A . E 3 HOH 137 459 137 HOH HOH A . E 3 HOH 138 460 138 HOH HOH A . E 3 HOH 139 461 139 HOH HOH A . E 3 HOH 140 462 140 HOH HOH A . E 3 HOH 141 463 141 HOH HOH A . E 3 HOH 142 464 142 HOH HOH A . E 3 HOH 143 465 143 HOH HOH A . E 3 HOH 144 466 144 HOH HOH A . E 3 HOH 145 467 145 HOH HOH A . E 3 HOH 146 468 146 HOH HOH A . E 3 HOH 147 469 147 HOH HOH A . E 3 HOH 148 470 148 HOH HOH A . E 3 HOH 149 471 149 HOH HOH A . E 3 HOH 150 472 150 HOH HOH A . E 3 HOH 151 473 151 HOH HOH A . E 3 HOH 152 474 152 HOH HOH A . E 3 HOH 153 475 153 HOH HOH A . E 3 HOH 154 476 154 HOH HOH A . E 3 HOH 155 477 155 HOH HOH A . E 3 HOH 156 478 156 HOH HOH A . E 3 HOH 157 479 157 HOH HOH A . E 3 HOH 158 480 158 HOH HOH A . E 3 HOH 159 481 159 HOH HOH A . E 3 HOH 160 482 160 HOH HOH A . E 3 HOH 161 483 161 HOH HOH A . E 3 HOH 162 484 162 HOH HOH A . E 3 HOH 163 485 163 HOH HOH A . E 3 HOH 164 486 164 HOH HOH A . E 3 HOH 165 487 165 HOH HOH A . E 3 HOH 166 488 166 HOH HOH A . E 3 HOH 167 489 167 HOH HOH A . E 3 HOH 168 490 168 HOH HOH A . E 3 HOH 169 491 169 HOH HOH A . E 3 HOH 170 492 170 HOH HOH A . E 3 HOH 171 493 171 HOH HOH A . E 3 HOH 172 494 172 HOH HOH A . E 3 HOH 173 495 173 HOH HOH A . E 3 HOH 174 496 174 HOH HOH A . E 3 HOH 175 497 175 HOH HOH A . E 3 HOH 176 498 176 HOH HOH A . E 3 HOH 177 499 177 HOH HOH A . E 3 HOH 178 500 178 HOH HOH A . E 3 HOH 179 501 179 HOH HOH A . E 3 HOH 180 502 180 HOH HOH A . E 3 HOH 181 503 181 HOH HOH A . E 3 HOH 182 504 182 HOH HOH A . E 3 HOH 183 505 183 HOH HOH A . E 3 HOH 184 506 184 HOH HOH A . E 3 HOH 185 507 185 HOH HOH A . E 3 HOH 186 508 186 HOH HOH A . E 3 HOH 187 509 187 HOH HOH A . E 3 HOH 188 510 188 HOH HOH A . E 3 HOH 189 511 189 HOH HOH A . E 3 HOH 190 512 190 HOH HOH A . E 3 HOH 191 513 191 HOH HOH A . E 3 HOH 192 514 192 HOH HOH A . E 3 HOH 193 515 193 HOH HOH A . E 3 HOH 194 516 194 HOH HOH A . E 3 HOH 195 517 195 HOH HOH A . E 3 HOH 196 518 196 HOH HOH A . E 3 HOH 197 519 197 HOH HOH A . E 3 HOH 198 520 198 HOH HOH A . E 3 HOH 199 521 199 HOH HOH A . E 3 HOH 200 522 200 HOH HOH A . E 3 HOH 201 523 201 HOH HOH A . E 3 HOH 202 524 202 HOH HOH A . E 3 HOH 203 525 203 HOH HOH A . E 3 HOH 204 526 204 HOH HOH A . E 3 HOH 205 527 205 HOH HOH A . E 3 HOH 206 528 206 HOH HOH A . E 3 HOH 207 529 207 HOH HOH A . E 3 HOH 208 530 208 HOH HOH A . E 3 HOH 209 531 209 HOH HOH A . E 3 HOH 210 532 210 HOH HOH A . E 3 HOH 211 533 211 HOH HOH A . E 3 HOH 212 534 212 HOH HOH A . E 3 HOH 213 535 213 HOH HOH A . E 3 HOH 214 536 214 HOH HOH A . E 3 HOH 215 537 215 HOH HOH A . E 3 HOH 216 538 216 HOH HOH A . E 3 HOH 217 539 217 HOH HOH A . E 3 HOH 218 540 218 HOH HOH A . E 3 HOH 219 541 219 HOH HOH A . E 3 HOH 220 542 220 HOH HOH A . E 3 HOH 221 543 221 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CXM 1 A CXM 1 ? MET N-CARBOXYMETHIONINE 2 A CME 50 A CME 50 ? CYS 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' 3 A CME 146 A CME 146 ? CYS 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' 4 A CME 168 A CME 168 ? CYS 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' 5 A CME 192 A CME 192 ? CYS 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA,PQS dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E 2 1,2 A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 5500 ? 2 MORE -99 ? 2 'SSA (A^2)' 21220 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 14_555 -x,-y+1/2,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 66.2185000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 480 ? E HOH . 2 1 A HOH 493 ? E HOH . 3 1 A HOH 541 ? E HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-06-14 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2021-11-03 5 'Structure model' 2 1 2022-04-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Atomic model' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' database_2 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_ref_seq_dif 5 4 'Structure model' struct_site 6 5 'Structure model' audit_author 7 5 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.occupancy' 2 4 'Structure model' '_database_2.pdbx_DOI' 3 4 'Structure model' '_database_2.pdbx_database_accession' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_ref_seq_dif.details' 6 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 4 'Structure model' '_struct_site.pdbx_auth_seq_id' 9 5 'Structure model' '_audit_author.identifier_ORCID' 10 5 'Structure model' '_citation_author.identifier_ORCID' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal AMoRE phasing . ? 1 CNS refinement 0.5 ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 NH2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ARG _pdbx_validate_symm_contact.auth_seq_id_1 53 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NH2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ARG _pdbx_validate_symm_contact.auth_seq_id_2 53 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 15_556 _pdbx_validate_symm_contact.dist 1.93 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 18 ? ? -154.27 -135.37 2 1 ARG A 21 ? ? -57.96 71.39 3 1 THR A 22 ? ? 53.93 99.73 4 1 TYR A 94 ? ? -16.40 -70.57 5 1 ALA A 100 ? ? -152.45 54.14 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 2 ? NZ ? A LYS 2 NZ 2 1 Y 1 A GLU 237 ? CG ? A GLU 237 CG 3 1 Y 1 A GLU 237 ? CD ? A GLU 237 CD 4 1 Y 1 A GLU 237 ? OE1 ? A GLU 237 OE1 5 1 Y 1 A GLU 237 ? OE2 ? A GLU 237 OE2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH #