data_1RI9 # _entry.id 1RI9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1RI9 pdb_00001ri9 10.2210/pdb1ri9/pdb RCSB RCSB020768 ? ? WWPDB D_1000020768 ? ? BMRB 5467 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 5467 _pdbx_database_related.details 'The same protein' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1RI9 _pdbx_database_status.recvd_initial_deposition_date 2003-11-17 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Heuer, K.' 1 'Kofler, M.' 2 'Langdon, G.' 3 'Thiemke, K.' 4 'Freund, C.' 5 # _citation.id primary _citation.title 'Structure of a Helically Extended SH3 Domain of the T Cell Adapter Protein ADAP.' _citation.journal_abbrev STRUCTURE _citation.journal_volume 12 _citation.page_first 603 _citation.page_last 610 _citation.year 2004 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15062083 _citation.pdbx_database_id_DOI 10.1016/j.str.2004.02.021 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Heuer, K.' 1 ? primary 'Kofler, M.' 2 ? primary 'Langdon, G.' 3 ? primary 'Thiemke, K.' 4 ? primary 'Freund, C.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'FYN-binding protein' _entity.formula_weight 11901.391 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RESIDUES 683-771 OF ADAP PROTEIN' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGKKLKKQEKEEKDFRKKFKYDGEIRVLYSTKVTTSITSKKWGTRDLQVKPGESLEVIQTTDDTKVLCR NEEGKYGYVLRSYLADNDGEIY ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGKKLKKQEKEEKDFRKKFKYDGEIRVLYSTKVTTSITSKKWGTRDLQVKPGESLEVIQTTDDTKVLCR NEEGKYGYVLRSYLADNDGEIY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LYS n 1 15 LYS n 1 16 LEU n 1 17 LYS n 1 18 LYS n 1 19 GLN n 1 20 GLU n 1 21 LYS n 1 22 GLU n 1 23 GLU n 1 24 LYS n 1 25 ASP n 1 26 PHE n 1 27 ARG n 1 28 LYS n 1 29 LYS n 1 30 PHE n 1 31 LYS n 1 32 TYR n 1 33 ASP n 1 34 GLY n 1 35 GLU n 1 36 ILE n 1 37 ARG n 1 38 VAL n 1 39 LEU n 1 40 TYR n 1 41 SER n 1 42 THR n 1 43 LYS n 1 44 VAL n 1 45 THR n 1 46 THR n 1 47 SER n 1 48 ILE n 1 49 THR n 1 50 SER n 1 51 LYS n 1 52 LYS n 1 53 TRP n 1 54 GLY n 1 55 THR n 1 56 ARG n 1 57 ASP n 1 58 LEU n 1 59 GLN n 1 60 VAL n 1 61 LYS n 1 62 PRO n 1 63 GLY n 1 64 GLU n 1 65 SER n 1 66 LEU n 1 67 GLU n 1 68 VAL n 1 69 ILE n 1 70 GLN n 1 71 THR n 1 72 THR n 1 73 ASP n 1 74 ASP n 1 75 THR n 1 76 LYS n 1 77 VAL n 1 78 LEU n 1 79 CYS n 1 80 ARG n 1 81 ASN n 1 82 GLU n 1 83 GLU n 1 84 GLY n 1 85 LYS n 1 86 TYR n 1 87 GLY n 1 88 TYR n 1 89 VAL n 1 90 LEU n 1 91 ARG n 1 92 SER n 1 93 TYR n 1 94 LEU n 1 95 ALA n 1 96 ASP n 1 97 ASN n 1 98 ASP n 1 99 GLY n 1 100 GLU n 1 101 ILE n 1 102 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'FYB, SLAP130' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pTFT74 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FYB_HUMAN _struct_ref.pdbx_db_accession O15117 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KKLKKQEKEEKDFRKKFKYDGEIRVLYSTKVTTSITSKKWGTRDLQVKPGESLEVIQTTDDTKVLCRNEEGKYGYVLRSY LADNDGEIY ; _struct_ref.pdbx_align_begin 683 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1RI9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 14 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 102 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O15117 _struct_ref_seq.db_align_beg 683 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 771 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 89 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1RI9 MET A 1 ? UNP O15117 ? ? insertion -12 1 1 1RI9 GLY A 2 ? UNP O15117 ? ? insertion -11 2 1 1RI9 SER A 3 ? UNP O15117 ? ? insertion -10 3 1 1RI9 SER A 4 ? UNP O15117 ? ? insertion -9 4 1 1RI9 HIS A 5 ? UNP O15117 ? ? insertion -8 5 1 1RI9 HIS A 6 ? UNP O15117 ? ? insertion -7 6 1 1RI9 HIS A 7 ? UNP O15117 ? ? insertion -6 7 1 1RI9 HIS A 8 ? UNP O15117 ? ? insertion -5 8 1 1RI9 HIS A 9 ? UNP O15117 ? ? insertion -4 9 1 1RI9 HIS A 10 ? UNP O15117 ? ? insertion -3 10 1 1RI9 SER A 11 ? UNP O15117 ? ? insertion -2 11 1 1RI9 SER A 12 ? UNP O15117 ? ? insertion -1 12 1 1RI9 GLY A 13 ? UNP O15117 ? ? insertion 0 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 '2D TOCSY' 3 1 1 3D_13C-separated_NOESY 4 1 1 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.3 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.05 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.8mM ADAP-hSH3 domain "[U-95% 13C; U-90% 15N]" ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1RI9 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ;the structures are based on a total of 1136 restraints, 718 are NOE-derived distance constraints, 388 dihedral angle restraints,30 distance restraints from hydrogen bonds. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1RI9 _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear and 3D heteronuclear techniques.' # _pdbx_nmr_ensemble.entry_id 1RI9 _pdbx_nmr_ensemble.conformers_calculated_total_number 51 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'The submitted conformer models are the 20 structures with the lowest energy.' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1RI9 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations,lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection 'Bruker GmbH' 1 XEASY 1.3.13 'data analysis' 'Bartels, C., Xia, T.H., Billeter, M., Guentert, P. and Wuethrich, K.' 2 CYANA 1.0.6 'structure solution' 'Guentert, P.' 3 CYANA 1.0.6 refinement 'Guentert, P.' 4 # _exptl.entry_id 1RI9 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1RI9 _struct.title 'Structure of a helically extended SH3 domain of the T cell adapter protein ADAP' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1RI9 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'SH3-LIKE, HELICALLY EXTENDED, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 20 ? PHE A 30 ? GLU A 7 PHE A 17 1 ? 11 HELX_P HELX_P2 2 SER A 92 ? LEU A 94 ? SER A 79 LEU A 81 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 67 ? THR A 71 ? GLU A 54 THR A 58 A 2 LYS A 76 ? ASN A 81 ? LYS A 63 ASN A 68 A 3 LYS A 85 ? LEU A 90 ? LYS A 72 LEU A 77 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 67 ? N GLU A 54 O ARG A 80 ? O ARG A 67 A 2 3 N CYS A 79 ? N CYS A 66 O GLY A 87 ? O GLY A 74 # _database_PDB_matrix.entry_id 1RI9 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1RI9 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -12 ? ? ? A . n A 1 2 GLY 2 -11 ? ? ? A . n A 1 3 SER 3 -10 ? ? ? A . n A 1 4 SER 4 -9 ? ? ? A . n A 1 5 HIS 5 -8 ? ? ? A . n A 1 6 HIS 6 -7 ? ? ? A . n A 1 7 HIS 7 -6 ? ? ? A . n A 1 8 HIS 8 -5 ? ? ? A . n A 1 9 HIS 9 -4 ? ? ? A . n A 1 10 HIS 10 -3 ? ? ? A . n A 1 11 SER 11 -2 ? ? ? A . n A 1 12 SER 12 -1 ? ? ? A . n A 1 13 GLY 13 0 ? ? ? A . n A 1 14 LYS 14 1 ? ? ? A . n A 1 15 LYS 15 2 ? ? ? A . n A 1 16 LEU 16 3 ? ? ? A . n A 1 17 LYS 17 4 ? ? ? A . n A 1 18 LYS 18 5 ? ? ? A . n A 1 19 GLN 19 6 ? ? ? A . n A 1 20 GLU 20 7 7 GLU GLU A . n A 1 21 LYS 21 8 8 LYS LYS A . n A 1 22 GLU 22 9 9 GLU GLU A . n A 1 23 GLU 23 10 10 GLU GLU A . n A 1 24 LYS 24 11 11 LYS LYS A . n A 1 25 ASP 25 12 12 ASP ASP A . n A 1 26 PHE 26 13 13 PHE PHE A . n A 1 27 ARG 27 14 14 ARG ARG A . n A 1 28 LYS 28 15 15 LYS LYS A . n A 1 29 LYS 29 16 16 LYS LYS A . n A 1 30 PHE 30 17 17 PHE PHE A . n A 1 31 LYS 31 18 18 LYS LYS A . n A 1 32 TYR 32 19 19 TYR TYR A . n A 1 33 ASP 33 20 20 ASP ASP A . n A 1 34 GLY 34 21 21 GLY GLY A . n A 1 35 GLU 35 22 22 GLU GLU A . n A 1 36 ILE 36 23 23 ILE ILE A . n A 1 37 ARG 37 24 24 ARG ARG A . n A 1 38 VAL 38 25 25 VAL VAL A . n A 1 39 LEU 39 26 26 LEU LEU A . n A 1 40 TYR 40 27 27 TYR TYR A . n A 1 41 SER 41 28 28 SER SER A . n A 1 42 THR 42 29 29 THR THR A . n A 1 43 LYS 43 30 30 LYS LYS A . n A 1 44 VAL 44 31 31 VAL VAL A . n A 1 45 THR 45 32 32 THR THR A . n A 1 46 THR 46 33 33 THR THR A . n A 1 47 SER 47 34 34 SER SER A . n A 1 48 ILE 48 35 35 ILE ILE A . n A 1 49 THR 49 36 36 THR THR A . n A 1 50 SER 50 37 37 SER SER A . n A 1 51 LYS 51 38 38 LYS LYS A . n A 1 52 LYS 52 39 39 LYS LYS A . n A 1 53 TRP 53 40 40 TRP TRP A . n A 1 54 GLY 54 41 41 GLY GLY A . n A 1 55 THR 55 42 42 THR THR A . n A 1 56 ARG 56 43 43 ARG ARG A . n A 1 57 ASP 57 44 44 ASP ASP A . n A 1 58 LEU 58 45 45 LEU LEU A . n A 1 59 GLN 59 46 46 GLN GLN A . n A 1 60 VAL 60 47 47 VAL VAL A . n A 1 61 LYS 61 48 48 LYS LYS A . n A 1 62 PRO 62 49 49 PRO PRO A . n A 1 63 GLY 63 50 50 GLY GLY A . n A 1 64 GLU 64 51 51 GLU GLU A . n A 1 65 SER 65 52 52 SER SER A . n A 1 66 LEU 66 53 53 LEU LEU A . n A 1 67 GLU 67 54 54 GLU GLU A . n A 1 68 VAL 68 55 55 VAL VAL A . n A 1 69 ILE 69 56 56 ILE ILE A . n A 1 70 GLN 70 57 57 GLN GLN A . n A 1 71 THR 71 58 58 THR THR A . n A 1 72 THR 72 59 59 THR THR A . n A 1 73 ASP 73 60 60 ASP ASP A . n A 1 74 ASP 74 61 61 ASP ASP A . n A 1 75 THR 75 62 62 THR THR A . n A 1 76 LYS 76 63 63 LYS LYS A . n A 1 77 VAL 77 64 64 VAL VAL A . n A 1 78 LEU 78 65 65 LEU LEU A . n A 1 79 CYS 79 66 66 CYS CYS A . n A 1 80 ARG 80 67 67 ARG ARG A . n A 1 81 ASN 81 68 68 ASN ASN A . n A 1 82 GLU 82 69 69 GLU GLU A . n A 1 83 GLU 83 70 70 GLU GLU A . n A 1 84 GLY 84 71 71 GLY GLY A . n A 1 85 LYS 85 72 72 LYS LYS A . n A 1 86 TYR 86 73 73 TYR TYR A . n A 1 87 GLY 87 74 74 GLY GLY A . n A 1 88 TYR 88 75 75 TYR TYR A . n A 1 89 VAL 89 76 76 VAL VAL A . n A 1 90 LEU 90 77 77 LEU LEU A . n A 1 91 ARG 91 78 78 ARG ARG A . n A 1 92 SER 92 79 79 SER SER A . n A 1 93 TYR 93 80 80 TYR TYR A . n A 1 94 LEU 94 81 81 LEU LEU A . n A 1 95 ALA 95 82 82 ALA ALA A . n A 1 96 ASP 96 83 83 ASP ASP A . n A 1 97 ASN 97 84 ? ? ? A . n A 1 98 ASP 98 85 ? ? ? A . n A 1 99 GLY 99 86 ? ? ? A . n A 1 100 GLU 100 87 ? ? ? A . n A 1 101 ILE 101 88 ? ? ? A . n A 1 102 TYR 102 89 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-04-20 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2020-02-05 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Database references' 8 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_struct_ref_seq_dif.details' 4 5 'Structure model' '_database_2.pdbx_DOI' 5 5 'Structure model' '_database_2.pdbx_database_accession' 6 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PHE 17 ? ? H A TYR 19 ? ? 1.09 2 1 HG21 A ILE 56 ? ? H A GLN 57 ? ? 1.14 3 1 HD11 A LEU 81 ? ? H A ALA 82 ? ? 1.26 4 1 C A PHE 17 ? ? H A TYR 19 ? ? 1.43 5 1 O A THR 32 ? ? H A ILE 35 ? ? 1.48 6 1 O A PHE 13 ? ? H A PHE 17 ? ? 1.53 7 1 O A PHE 17 ? ? N A TYR 19 ? ? 1.74 8 2 O A PHE 17 ? ? H A TYR 19 ? ? 1.09 9 2 HG21 A ILE 56 ? ? H A GLN 57 ? ? 1.14 10 2 HD11 A LEU 81 ? ? H A ALA 82 ? ? 1.26 11 2 HG23 A ILE 23 ? ? HH A TYR 73 ? ? 1.30 12 2 C A PHE 17 ? ? H A TYR 19 ? ? 1.43 13 2 O A THR 32 ? ? H A ILE 35 ? ? 1.46 14 2 O A PHE 13 ? ? H A PHE 17 ? ? 1.48 15 2 O A PHE 17 ? ? N A TYR 19 ? ? 1.74 16 3 O A PHE 17 ? ? H A TYR 19 ? ? 1.10 17 3 HG21 A ILE 56 ? ? H A GLN 57 ? ? 1.14 18 3 C A PHE 17 ? ? H A TYR 19 ? ? 1.43 19 3 O A PHE 13 ? ? H A PHE 17 ? ? 1.52 20 3 O A PHE 17 ? ? N A TYR 19 ? ? 1.73 21 4 O A PHE 17 ? ? H A TYR 19 ? ? 1.09 22 4 HG21 A ILE 56 ? ? H A GLN 57 ? ? 1.13 23 4 HD11 A LEU 81 ? ? H A ALA 82 ? ? 1.25 24 4 HG13 A VAL 25 ? ? HG2 A GLU 54 ? ? 1.33 25 4 HG21 A THR 32 ? ? H A SER 34 ? ? 1.34 26 4 C A PHE 17 ? ? H A TYR 19 ? ? 1.43 27 4 O A THR 32 ? ? H A ILE 35 ? ? 1.47 28 4 O A PHE 13 ? ? H A PHE 17 ? ? 1.48 29 4 O A PHE 17 ? ? N A TYR 19 ? ? 1.74 30 5 HD21 A LEU 81 ? ? H A ALA 82 ? ? 1.05 31 5 HG23 A THR 29 ? ? HD23 A LEU 81 ? ? 1.08 32 5 O A PHE 17 ? ? H A TYR 19 ? ? 1.09 33 5 HG21 A ILE 56 ? ? H A GLN 57 ? ? 1.15 34 5 HG13 A VAL 25 ? ? HG2 A GLU 54 ? ? 1.30 35 5 C A PHE 17 ? ? H A TYR 19 ? ? 1.43 36 5 HD12 A LEU 81 ? ? O A ALA 82 ? ? 1.49 37 5 O A PHE 13 ? ? H A PHE 17 ? ? 1.53 38 5 O A PHE 17 ? ? N A TYR 19 ? ? 1.73 39 6 O A PHE 17 ? ? H A TYR 19 ? ? 1.09 40 6 HG21 A ILE 56 ? ? H A GLN 57 ? ? 1.11 41 6 HD21 A LEU 81 ? ? H A ALA 82 ? ? 1.15 42 6 HG23 A THR 29 ? ? HD23 A LEU 81 ? ? 1.19 43 6 C A PHE 17 ? ? H A TYR 19 ? ? 1.42 44 6 H A ILE 56 ? ? O A LEU 65 ? ? 1.48 45 6 HD12 A LEU 81 ? ? O A ALA 82 ? ? 1.51 46 6 O A PHE 13 ? ? H A PHE 17 ? ? 1.51 47 6 O A PHE 17 ? ? N A TYR 19 ? ? 1.73 48 7 O A PHE 17 ? ? H A TYR 19 ? ? 1.09 49 7 HG21 A ILE 56 ? ? H A GLN 57 ? ? 1.15 50 7 HG21 A THR 32 ? ? H A SER 34 ? ? 1.33 51 7 C A PHE 17 ? ? H A TYR 19 ? ? 1.43 52 7 O A THR 32 ? ? H A ILE 35 ? ? 1.47 53 7 O A PHE 13 ? ? H A PHE 17 ? ? 1.47 54 7 O A ASN 68 ? ? H A GLY 71 ? ? 1.57 55 7 O A PHE 17 ? ? N A TYR 19 ? ? 1.74 56 8 O A PHE 17 ? ? H A TYR 19 ? ? 1.07 57 8 HG21 A ILE 56 ? ? H A GLN 57 ? ? 1.13 58 8 HG23 A ILE 23 ? ? HH A TYR 73 ? ? 1.24 59 8 HD11 A LEU 81 ? ? H A ALA 82 ? ? 1.27 60 8 O A PHE 13 ? ? H A PHE 17 ? ? 1.40 61 8 C A PHE 17 ? ? H A TYR 19 ? ? 1.42 62 8 O A THR 32 ? ? H A ILE 35 ? ? 1.47 63 8 O A PHE 17 ? ? N A TYR 19 ? ? 1.73 64 9 HD21 A LEU 81 ? ? H A ALA 82 ? ? 1.08 65 9 O A PHE 17 ? ? H A TYR 19 ? ? 1.10 66 9 HG23 A THR 29 ? ? HD23 A LEU 81 ? ? 1.13 67 9 HG21 A ILE 56 ? ? H A GLN 57 ? ? 1.15 68 9 HG22 A THR 32 ? ? H A SER 34 ? ? 1.29 69 9 C A PHE 17 ? ? H A TYR 19 ? ? 1.43 70 9 HD12 A LEU 81 ? ? O A ALA 82 ? ? 1.49 71 9 O A PHE 13 ? ? H A PHE 17 ? ? 1.50 72 9 H A ILE 56 ? ? O A LEU 65 ? ? 1.59 73 9 O A PHE 17 ? ? N A TYR 19 ? ? 1.73 74 10 O A PHE 17 ? ? H A TYR 19 ? ? 1.09 75 10 HG21 A ILE 56 ? ? H A GLN 57 ? ? 1.14 76 10 HG13 A VAL 25 ? ? HG2 A GLU 54 ? ? 1.33 77 10 C A PHE 17 ? ? H A TYR 19 ? ? 1.42 78 10 HD21 A LEU 81 ? ? N A ALA 82 ? ? 1.50 79 10 O A PHE 13 ? ? H A PHE 17 ? ? 1.52 80 10 O A PHE 17 ? ? N A TYR 19 ? ? 1.73 81 11 O A PHE 17 ? ? H A TYR 19 ? ? 1.10 82 11 HG21 A ILE 56 ? ? H A GLN 57 ? ? 1.16 83 11 HD22 A LEU 81 ? ? H A ALA 82 ? ? 1.31 84 11 HG23 A ILE 23 ? ? HH A TYR 73 ? ? 1.33 85 11 C A PHE 17 ? ? H A TYR 19 ? ? 1.43 86 11 O A PHE 13 ? ? H A PHE 17 ? ? 1.54 87 11 O A PHE 17 ? ? N A TYR 19 ? ? 1.73 88 12 O A PHE 17 ? ? H A TYR 19 ? ? 1.09 89 12 HD22 A LEU 81 ? ? H A ALA 82 ? ? 1.13 90 12 HG21 A ILE 56 ? ? H A GLN 57 ? ? 1.20 91 12 HG13 A VAL 25 ? ? HG2 A GLU 54 ? ? 1.32 92 12 HG22 A THR 32 ? ? H A SER 34 ? ? 1.34 93 12 HH A TYR 27 ? ? HG11 A VAL 64 ? ? 1.35 94 12 C A PHE 17 ? ? H A TYR 19 ? ? 1.42 95 12 HD11 A LEU 65 ? ? O A GLY 74 ? ? 1.53 96 12 O A PHE 13 ? ? H A PHE 17 ? ? 1.53 97 12 O A PHE 17 ? ? N A TYR 19 ? ? 1.73 98 13 O A PHE 17 ? ? H A TYR 19 ? ? 1.09 99 13 HG21 A ILE 56 ? ? H A GLN 57 ? ? 1.18 100 13 HD11 A LEU 81 ? ? H A ALA 82 ? ? 1.26 101 13 HG13 A VAL 25 ? ? HG2 A GLU 54 ? ? 1.31 102 13 HG21 A THR 32 ? ? H A SER 34 ? ? 1.33 103 13 C A PHE 17 ? ? H A TYR 19 ? ? 1.43 104 13 O A THR 32 ? ? H A ILE 35 ? ? 1.49 105 13 O A PHE 13 ? ? H A PHE 17 ? ? 1.49 106 13 O A PHE 17 ? ? N A TYR 19 ? ? 1.75 107 14 HD21 A LEU 53 ? ? H A GLU 54 ? ? 1.05 108 14 O A PHE 17 ? ? H A TYR 19 ? ? 1.08 109 14 HH A TYR 27 ? ? HG11 A VAL 64 ? ? 1.16 110 14 HG21 A ILE 56 ? ? H A GLN 57 ? ? 1.18 111 14 HD11 A LEU 81 ? ? H A ALA 82 ? ? 1.24 112 14 HG23 A ILE 23 ? ? HH A TYR 73 ? ? 1.26 113 14 HD23 A LEU 53 ? ? H A ARG 67 ? ? 1.27 114 14 C A PHE 17 ? ? H A TYR 19 ? ? 1.42 115 14 O A PHE 13 ? ? H A PHE 17 ? ? 1.51 116 14 O A PHE 17 ? ? N A TYR 19 ? ? 1.73 117 15 O A PHE 17 ? ? H A TYR 19 ? ? 1.09 118 15 HG21 A ILE 56 ? ? H A GLN 57 ? ? 1.16 119 15 HD11 A LEU 81 ? ? H A ALA 82 ? ? 1.23 120 15 HG23 A THR 29 ? ? HD13 A LEU 81 ? ? 1.29 121 15 HG22 A THR 32 ? ? H A SER 34 ? ? 1.29 122 15 C A PHE 17 ? ? H A TYR 19 ? ? 1.42 123 15 O A PHE 13 ? ? H A PHE 17 ? ? 1.44 124 15 O A PHE 17 ? ? N A TYR 19 ? ? 1.73 125 16 O A PHE 17 ? ? H A TYR 19 ? ? 1.07 126 16 HG21 A ILE 56 ? ? H A GLN 57 ? ? 1.14 127 16 HD11 A LEU 81 ? ? H A ALA 82 ? ? 1.25 128 16 O A PHE 13 ? ? H A PHE 17 ? ? 1.41 129 16 C A PHE 17 ? ? H A TYR 19 ? ? 1.42 130 16 O A PHE 17 ? ? N A TYR 19 ? ? 1.73 131 17 O A PHE 17 ? ? H A TYR 19 ? ? 1.09 132 17 HG21 A ILE 56 ? ? H A GLN 57 ? ? 1.13 133 17 HD11 A LEU 81 ? ? H A ALA 82 ? ? 1.18 134 17 HG23 A ILE 23 ? ? HH A TYR 73 ? ? 1.31 135 17 C A PHE 17 ? ? H A TYR 19 ? ? 1.43 136 17 O A PHE 13 ? ? H A PHE 17 ? ? 1.50 137 17 O A THR 32 ? ? H A ILE 35 ? ? 1.50 138 17 O A PHE 17 ? ? N A TYR 19 ? ? 1.74 139 18 O A PHE 17 ? ? H A TYR 19 ? ? 1.10 140 18 HG21 A ILE 56 ? ? H A GLN 57 ? ? 1.13 141 18 HD11 A LEU 81 ? ? H A ALA 82 ? ? 1.31 142 18 HG21 A THR 32 ? ? H A SER 34 ? ? 1.33 143 18 C A PHE 17 ? ? H A TYR 19 ? ? 1.42 144 18 O A THR 32 ? ? H A ILE 35 ? ? 1.47 145 18 O A PHE 13 ? ? H A PHE 17 ? ? 1.53 146 18 O A VAL 64 ? ? HG11 A VAL 76 ? ? 1.53 147 18 HD11 A LEU 65 ? ? O A GLY 74 ? ? 1.57 148 18 O A PHE 17 ? ? N A TYR 19 ? ? 1.73 149 19 O A PHE 17 ? ? H A TYR 19 ? ? 1.09 150 19 HG21 A ILE 56 ? ? H A GLN 57 ? ? 1.15 151 19 HD21 A LEU 81 ? ? H A ALA 82 ? ? 1.15 152 19 HG23 A THR 29 ? ? HD23 A LEU 81 ? ? 1.21 153 19 HG23 A VAL 25 ? ? HG2 A GLU 54 ? ? 1.31 154 19 C A PHE 17 ? ? H A TYR 19 ? ? 1.42 155 19 O A PHE 13 ? ? H A PHE 17 ? ? 1.43 156 19 HD12 A LEU 81 ? ? O A ALA 82 ? ? 1.54 157 19 HD21 A LEU 81 ? ? N A ALA 82 ? ? 1.55 158 19 HG13 A VAL 25 ? ? OE2 A GLU 54 ? ? 1.57 159 19 O A PHE 17 ? ? N A TYR 19 ? ? 1.73 160 20 O A PHE 17 ? ? H A TYR 19 ? ? 1.10 161 20 HG21 A ILE 56 ? ? H A GLN 57 ? ? 1.13 162 20 HG21 A THR 32 ? ? H A SER 34 ? ? 1.34 163 20 C A PHE 17 ? ? H A TYR 19 ? ? 1.43 164 20 O A THR 32 ? ? H A ILE 35 ? ? 1.45 165 20 HD21 A LEU 81 ? ? N A ALA 82 ? ? 1.50 166 20 O A VAL 64 ? ? HG11 A VAL 76 ? ? 1.51 167 20 O A PHE 13 ? ? H A PHE 17 ? ? 1.53 168 20 H A ILE 56 ? ? O A LEU 65 ? ? 1.54 169 20 O A PHE 17 ? ? N A TYR 19 ? ? 1.73 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 18 ? ? -35.53 7.90 2 1 VAL A 25 ? ? -66.31 99.46 3 1 THR A 33 ? ? -43.51 -19.92 4 1 GLN A 46 ? ? -88.07 31.28 5 1 ILE A 56 ? ? -91.46 -138.06 6 1 THR A 59 ? ? -54.24 -74.28 7 1 ASP A 60 ? ? -104.64 -91.58 8 1 THR A 62 ? ? -117.84 69.98 9 2 LYS A 18 ? ? -36.01 8.43 10 2 THR A 33 ? ? -44.57 -17.85 11 2 GLN A 46 ? ? -88.05 30.78 12 2 ILE A 56 ? ? -91.97 -137.91 13 2 THR A 59 ? ? -54.67 -74.10 14 2 ASP A 60 ? ? -104.58 -92.01 15 2 THR A 62 ? ? -117.56 69.44 16 3 LYS A 18 ? ? -35.04 7.01 17 3 VAL A 25 ? ? -65.82 99.59 18 3 GLN A 46 ? ? -89.20 31.48 19 3 ILE A 56 ? ? -91.64 -138.69 20 3 THR A 59 ? ? -55.11 -75.16 21 3 ASP A 60 ? ? -104.78 -91.63 22 3 THR A 62 ? ? -117.47 68.74 23 3 GLU A 70 ? ? -59.16 -9.30 24 4 LYS A 18 ? ? -35.59 7.75 25 4 THR A 33 ? ? -44.80 -16.89 26 4 GLN A 46 ? ? -87.48 31.10 27 4 ILE A 56 ? ? -92.45 -138.09 28 4 THR A 59 ? ? -54.81 -75.33 29 4 ASP A 60 ? ? -105.24 -91.33 30 4 THR A 62 ? ? -117.67 69.16 31 5 LYS A 18 ? ? -35.20 7.39 32 5 GLN A 46 ? ? -88.98 33.60 33 5 ILE A 56 ? ? -93.15 -137.19 34 5 THR A 59 ? ? -55.34 -74.38 35 5 ASP A 60 ? ? -104.71 -91.72 36 5 THR A 62 ? ? -117.68 69.56 37 5 ALA A 82 ? ? -54.58 174.23 38 6 PHE A 17 ? ? -87.42 30.10 39 6 LYS A 18 ? ? -34.54 6.64 40 6 VAL A 25 ? ? -65.62 98.86 41 6 GLN A 46 ? ? -88.21 31.38 42 6 ILE A 56 ? ? -92.72 -140.02 43 6 THR A 59 ? ? -61.21 -75.40 44 6 ASP A 60 ? ? -105.42 -92.64 45 6 THR A 62 ? ? -115.38 67.76 46 6 ALA A 82 ? ? -55.08 174.53 47 7 LYS A 18 ? ? -35.52 7.75 48 7 THR A 33 ? ? -47.39 -11.51 49 7 GLN A 46 ? ? -87.60 31.53 50 7 ILE A 56 ? ? -92.33 -138.29 51 7 THR A 59 ? ? -54.96 -74.48 52 7 ASP A 60 ? ? -104.58 -91.17 53 7 THR A 62 ? ? -117.53 69.13 54 8 PHE A 17 ? ? -87.41 30.59 55 8 LYS A 18 ? ? -35.57 8.30 56 8 GLN A 46 ? ? -88.07 31.24 57 8 ILE A 56 ? ? -91.40 -138.54 58 8 THR A 59 ? ? -54.53 -74.02 59 8 ASP A 60 ? ? -104.76 -91.45 60 8 THR A 62 ? ? -117.92 69.82 61 9 LYS A 18 ? ? -34.96 6.97 62 9 GLN A 46 ? ? -88.74 31.59 63 9 ILE A 56 ? ? -92.26 -137.63 64 9 THR A 59 ? ? -54.78 -74.60 65 9 ASP A 60 ? ? -104.90 -91.68 66 9 THR A 62 ? ? -117.53 69.52 67 9 ALA A 82 ? ? -55.45 174.80 68 10 LYS A 18 ? ? -34.87 7.02 69 10 VAL A 25 ? ? -66.33 99.88 70 10 GLN A 46 ? ? -88.46 31.38 71 10 ILE A 56 ? ? -91.92 -137.78 72 10 THR A 59 ? ? -56.08 -74.88 73 10 ASP A 60 ? ? -105.61 -91.52 74 10 THR A 62 ? ? -116.96 69.09 75 10 TYR A 80 ? ? -117.98 79.93 76 10 ALA A 82 ? ? -53.96 171.28 77 11 LYS A 18 ? ? -34.95 6.95 78 11 VAL A 25 ? ? -65.10 99.01 79 11 GLN A 46 ? ? -89.32 30.85 80 11 ILE A 56 ? ? -92.98 -137.54 81 11 THR A 59 ? ? -54.51 -74.27 82 11 ASP A 60 ? ? -104.82 -91.91 83 11 THR A 62 ? ? -117.83 68.66 84 11 GLU A 69 ? ? -58.82 -8.89 85 12 LYS A 18 ? ? -34.80 6.97 86 12 VAL A 25 ? ? -65.53 99.91 87 12 GLN A 46 ? ? -89.27 31.39 88 12 ILE A 56 ? ? -93.35 -138.29 89 12 THR A 59 ? ? -53.47 -75.38 90 12 ASP A 60 ? ? -105.47 -91.07 91 12 THR A 62 ? ? -118.84 69.45 92 12 GLU A 69 ? ? -58.29 -8.69 93 13 LYS A 18 ? ? -36.31 8.78 94 13 THR A 33 ? ? -44.53 -17.96 95 13 GLN A 46 ? ? -88.70 31.16 96 13 ILE A 56 ? ? -92.93 -136.43 97 13 THR A 59 ? ? -54.10 -74.57 98 13 ASP A 60 ? ? -105.16 -91.23 99 13 THR A 62 ? ? -118.34 68.76 100 14 LYS A 18 ? ? -35.49 7.98 101 14 VAL A 25 ? ? -66.39 99.81 102 14 GLN A 46 ? ? -89.35 31.50 103 14 ILE A 56 ? ? -92.97 -137.99 104 14 THR A 59 ? ? -53.92 -73.87 105 14 ASP A 60 ? ? -104.40 -91.29 106 14 THR A 62 ? ? -119.21 69.42 107 14 GLU A 70 ? ? -59.75 -9.04 108 15 LYS A 18 ? ? -35.20 7.56 109 15 GLN A 46 ? ? -89.11 30.54 110 15 ILE A 56 ? ? -93.19 -137.15 111 15 THR A 59 ? ? -54.51 -74.62 112 15 ASP A 60 ? ? -105.47 -91.09 113 15 THR A 62 ? ? -118.11 68.83 114 16 LYS A 18 ? ? -35.45 8.30 115 16 VAL A 25 ? ? -66.04 99.26 116 16 GLN A 46 ? ? -88.45 30.76 117 16 ILE A 56 ? ? -91.82 -136.36 118 16 THR A 59 ? ? -54.30 -75.24 119 16 ASP A 60 ? ? -105.77 -91.56 120 16 THR A 62 ? ? -117.91 68.74 121 17 LYS A 18 ? ? -35.38 7.66 122 17 THR A 33 ? ? -46.85 -14.67 123 17 GLN A 46 ? ? -88.20 31.20 124 17 ILE A 56 ? ? -92.15 -137.11 125 17 THR A 59 ? ? -55.34 -75.54 126 17 ASP A 60 ? ? -105.72 -91.18 127 17 THR A 62 ? ? -117.52 68.30 128 18 LYS A 18 ? ? -34.64 6.62 129 18 THR A 33 ? ? -46.13 -15.09 130 18 GLN A 46 ? ? -88.26 33.09 131 18 ILE A 56 ? ? -93.21 -137.55 132 18 THR A 59 ? ? -54.42 -75.63 133 18 ASP A 60 ? ? -105.59 -91.25 134 18 THR A 62 ? ? -117.37 69.07 135 19 LYS A 18 ? ? -34.85 7.10 136 19 GLN A 46 ? ? -88.98 31.64 137 19 ILE A 56 ? ? -92.78 -137.75 138 19 THR A 59 ? ? -54.01 -75.35 139 19 ASP A 60 ? ? -105.56 -91.61 140 19 THR A 62 ? ? -117.67 68.87 141 20 LYS A 18 ? ? -34.96 6.91 142 20 VAL A 25 ? ? -66.61 99.55 143 20 THR A 33 ? ? -47.53 -11.56 144 20 GLN A 46 ? ? -88.92 32.74 145 20 ILE A 56 ? ? -91.62 -140.92 146 20 THR A 59 ? ? -58.55 -75.63 147 20 ASP A 60 ? ? -105.65 -92.15 148 20 THR A 62 ? ? -115.02 67.09 149 20 GLU A 70 ? ? -59.12 -9.65 150 20 ALA A 82 ? ? -55.08 171.77 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -12 ? A MET 1 2 1 Y 1 A GLY -11 ? A GLY 2 3 1 Y 1 A SER -10 ? A SER 3 4 1 Y 1 A SER -9 ? A SER 4 5 1 Y 1 A HIS -8 ? A HIS 5 6 1 Y 1 A HIS -7 ? A HIS 6 7 1 Y 1 A HIS -6 ? A HIS 7 8 1 Y 1 A HIS -5 ? A HIS 8 9 1 Y 1 A HIS -4 ? A HIS 9 10 1 Y 1 A HIS -3 ? A HIS 10 11 1 Y 1 A SER -2 ? A SER 11 12 1 Y 1 A SER -1 ? A SER 12 13 1 Y 1 A GLY 0 ? A GLY 13 14 1 Y 1 A LYS 1 ? A LYS 14 15 1 Y 1 A LYS 2 ? A LYS 15 16 1 Y 1 A LEU 3 ? A LEU 16 17 1 Y 1 A LYS 4 ? A LYS 17 18 1 Y 1 A LYS 5 ? A LYS 18 19 1 Y 1 A GLN 6 ? A GLN 19 20 1 Y 1 A ASN 84 ? A ASN 97 21 1 Y 1 A ASP 85 ? A ASP 98 22 1 Y 1 A GLY 86 ? A GLY 99 23 1 Y 1 A GLU 87 ? A GLU 100 24 1 Y 1 A ILE 88 ? A ILE 101 25 1 Y 1 A TYR 89 ? A TYR 102 26 2 Y 1 A MET -12 ? A MET 1 27 2 Y 1 A GLY -11 ? A GLY 2 28 2 Y 1 A SER -10 ? A SER 3 29 2 Y 1 A SER -9 ? A SER 4 30 2 Y 1 A HIS -8 ? A HIS 5 31 2 Y 1 A HIS -7 ? A HIS 6 32 2 Y 1 A HIS -6 ? A HIS 7 33 2 Y 1 A HIS -5 ? A HIS 8 34 2 Y 1 A HIS -4 ? A HIS 9 35 2 Y 1 A HIS -3 ? A HIS 10 36 2 Y 1 A SER -2 ? A SER 11 37 2 Y 1 A SER -1 ? A SER 12 38 2 Y 1 A GLY 0 ? A GLY 13 39 2 Y 1 A LYS 1 ? A LYS 14 40 2 Y 1 A LYS 2 ? A LYS 15 41 2 Y 1 A LEU 3 ? A LEU 16 42 2 Y 1 A LYS 4 ? A LYS 17 43 2 Y 1 A LYS 5 ? A LYS 18 44 2 Y 1 A GLN 6 ? A GLN 19 45 2 Y 1 A ASN 84 ? A ASN 97 46 2 Y 1 A ASP 85 ? A ASP 98 47 2 Y 1 A GLY 86 ? A GLY 99 48 2 Y 1 A GLU 87 ? A GLU 100 49 2 Y 1 A ILE 88 ? A ILE 101 50 2 Y 1 A TYR 89 ? A TYR 102 51 3 Y 1 A MET -12 ? A MET 1 52 3 Y 1 A GLY -11 ? A GLY 2 53 3 Y 1 A SER -10 ? A SER 3 54 3 Y 1 A SER -9 ? A SER 4 55 3 Y 1 A HIS -8 ? A HIS 5 56 3 Y 1 A HIS -7 ? A HIS 6 57 3 Y 1 A HIS -6 ? A HIS 7 58 3 Y 1 A HIS -5 ? A HIS 8 59 3 Y 1 A HIS -4 ? A HIS 9 60 3 Y 1 A HIS -3 ? A HIS 10 61 3 Y 1 A SER -2 ? A SER 11 62 3 Y 1 A SER -1 ? A SER 12 63 3 Y 1 A GLY 0 ? A GLY 13 64 3 Y 1 A LYS 1 ? A LYS 14 65 3 Y 1 A LYS 2 ? A LYS 15 66 3 Y 1 A LEU 3 ? A LEU 16 67 3 Y 1 A LYS 4 ? A LYS 17 68 3 Y 1 A LYS 5 ? A LYS 18 69 3 Y 1 A GLN 6 ? A GLN 19 70 3 Y 1 A ASN 84 ? A ASN 97 71 3 Y 1 A ASP 85 ? A ASP 98 72 3 Y 1 A GLY 86 ? A GLY 99 73 3 Y 1 A GLU 87 ? A GLU 100 74 3 Y 1 A ILE 88 ? A ILE 101 75 3 Y 1 A TYR 89 ? A TYR 102 76 4 Y 1 A MET -12 ? A MET 1 77 4 Y 1 A GLY -11 ? A GLY 2 78 4 Y 1 A SER -10 ? A SER 3 79 4 Y 1 A SER -9 ? A SER 4 80 4 Y 1 A HIS -8 ? A HIS 5 81 4 Y 1 A HIS -7 ? A HIS 6 82 4 Y 1 A HIS -6 ? A HIS 7 83 4 Y 1 A HIS -5 ? A HIS 8 84 4 Y 1 A HIS -4 ? A HIS 9 85 4 Y 1 A HIS -3 ? A HIS 10 86 4 Y 1 A SER -2 ? A SER 11 87 4 Y 1 A SER -1 ? A SER 12 88 4 Y 1 A GLY 0 ? A GLY 13 89 4 Y 1 A LYS 1 ? A LYS 14 90 4 Y 1 A LYS 2 ? A LYS 15 91 4 Y 1 A LEU 3 ? A LEU 16 92 4 Y 1 A LYS 4 ? A LYS 17 93 4 Y 1 A LYS 5 ? A LYS 18 94 4 Y 1 A GLN 6 ? A GLN 19 95 4 Y 1 A ASN 84 ? A ASN 97 96 4 Y 1 A ASP 85 ? A ASP 98 97 4 Y 1 A GLY 86 ? A GLY 99 98 4 Y 1 A GLU 87 ? A GLU 100 99 4 Y 1 A ILE 88 ? A ILE 101 100 4 Y 1 A TYR 89 ? A TYR 102 101 5 Y 1 A MET -12 ? A MET 1 102 5 Y 1 A GLY -11 ? A GLY 2 103 5 Y 1 A SER -10 ? A SER 3 104 5 Y 1 A SER -9 ? A SER 4 105 5 Y 1 A HIS -8 ? A HIS 5 106 5 Y 1 A HIS -7 ? A HIS 6 107 5 Y 1 A HIS -6 ? A HIS 7 108 5 Y 1 A HIS -5 ? A HIS 8 109 5 Y 1 A HIS -4 ? A HIS 9 110 5 Y 1 A HIS -3 ? A HIS 10 111 5 Y 1 A SER -2 ? A SER 11 112 5 Y 1 A SER -1 ? A SER 12 113 5 Y 1 A GLY 0 ? A GLY 13 114 5 Y 1 A LYS 1 ? A LYS 14 115 5 Y 1 A LYS 2 ? A LYS 15 116 5 Y 1 A LEU 3 ? A LEU 16 117 5 Y 1 A LYS 4 ? A LYS 17 118 5 Y 1 A LYS 5 ? A LYS 18 119 5 Y 1 A GLN 6 ? A GLN 19 120 5 Y 1 A ASN 84 ? A ASN 97 121 5 Y 1 A ASP 85 ? A ASP 98 122 5 Y 1 A GLY 86 ? A GLY 99 123 5 Y 1 A GLU 87 ? A GLU 100 124 5 Y 1 A ILE 88 ? A ILE 101 125 5 Y 1 A TYR 89 ? A TYR 102 126 6 Y 1 A MET -12 ? A MET 1 127 6 Y 1 A GLY -11 ? A GLY 2 128 6 Y 1 A SER -10 ? A SER 3 129 6 Y 1 A SER -9 ? A SER 4 130 6 Y 1 A HIS -8 ? A HIS 5 131 6 Y 1 A HIS -7 ? A HIS 6 132 6 Y 1 A HIS -6 ? A HIS 7 133 6 Y 1 A HIS -5 ? A HIS 8 134 6 Y 1 A HIS -4 ? A HIS 9 135 6 Y 1 A HIS -3 ? A HIS 10 136 6 Y 1 A SER -2 ? A SER 11 137 6 Y 1 A SER -1 ? A SER 12 138 6 Y 1 A GLY 0 ? A GLY 13 139 6 Y 1 A LYS 1 ? A LYS 14 140 6 Y 1 A LYS 2 ? A LYS 15 141 6 Y 1 A LEU 3 ? A LEU 16 142 6 Y 1 A LYS 4 ? A LYS 17 143 6 Y 1 A LYS 5 ? A LYS 18 144 6 Y 1 A GLN 6 ? A GLN 19 145 6 Y 1 A ASN 84 ? A ASN 97 146 6 Y 1 A ASP 85 ? A ASP 98 147 6 Y 1 A GLY 86 ? A GLY 99 148 6 Y 1 A GLU 87 ? A GLU 100 149 6 Y 1 A ILE 88 ? A ILE 101 150 6 Y 1 A TYR 89 ? A TYR 102 151 7 Y 1 A MET -12 ? A MET 1 152 7 Y 1 A GLY -11 ? A GLY 2 153 7 Y 1 A SER -10 ? A SER 3 154 7 Y 1 A SER -9 ? A SER 4 155 7 Y 1 A HIS -8 ? A HIS 5 156 7 Y 1 A HIS -7 ? A HIS 6 157 7 Y 1 A HIS -6 ? A HIS 7 158 7 Y 1 A HIS -5 ? A HIS 8 159 7 Y 1 A HIS -4 ? A HIS 9 160 7 Y 1 A HIS -3 ? A HIS 10 161 7 Y 1 A SER -2 ? A SER 11 162 7 Y 1 A SER -1 ? A SER 12 163 7 Y 1 A GLY 0 ? A GLY 13 164 7 Y 1 A LYS 1 ? A LYS 14 165 7 Y 1 A LYS 2 ? A LYS 15 166 7 Y 1 A LEU 3 ? A LEU 16 167 7 Y 1 A LYS 4 ? A LYS 17 168 7 Y 1 A LYS 5 ? A LYS 18 169 7 Y 1 A GLN 6 ? A GLN 19 170 7 Y 1 A ASN 84 ? A ASN 97 171 7 Y 1 A ASP 85 ? A ASP 98 172 7 Y 1 A GLY 86 ? A GLY 99 173 7 Y 1 A GLU 87 ? A GLU 100 174 7 Y 1 A ILE 88 ? A ILE 101 175 7 Y 1 A TYR 89 ? A TYR 102 176 8 Y 1 A MET -12 ? A MET 1 177 8 Y 1 A GLY -11 ? A GLY 2 178 8 Y 1 A SER -10 ? A SER 3 179 8 Y 1 A SER -9 ? A SER 4 180 8 Y 1 A HIS -8 ? A HIS 5 181 8 Y 1 A HIS -7 ? A HIS 6 182 8 Y 1 A HIS -6 ? A HIS 7 183 8 Y 1 A HIS -5 ? A HIS 8 184 8 Y 1 A HIS -4 ? A HIS 9 185 8 Y 1 A HIS -3 ? A HIS 10 186 8 Y 1 A SER -2 ? A SER 11 187 8 Y 1 A SER -1 ? A SER 12 188 8 Y 1 A GLY 0 ? A GLY 13 189 8 Y 1 A LYS 1 ? A LYS 14 190 8 Y 1 A LYS 2 ? A LYS 15 191 8 Y 1 A LEU 3 ? A LEU 16 192 8 Y 1 A LYS 4 ? A LYS 17 193 8 Y 1 A LYS 5 ? A LYS 18 194 8 Y 1 A GLN 6 ? A GLN 19 195 8 Y 1 A ASN 84 ? A ASN 97 196 8 Y 1 A ASP 85 ? A ASP 98 197 8 Y 1 A GLY 86 ? A GLY 99 198 8 Y 1 A GLU 87 ? A GLU 100 199 8 Y 1 A ILE 88 ? A ILE 101 200 8 Y 1 A TYR 89 ? A TYR 102 201 9 Y 1 A MET -12 ? A MET 1 202 9 Y 1 A GLY -11 ? A GLY 2 203 9 Y 1 A SER -10 ? A SER 3 204 9 Y 1 A SER -9 ? A SER 4 205 9 Y 1 A HIS -8 ? A HIS 5 206 9 Y 1 A HIS -7 ? A HIS 6 207 9 Y 1 A HIS -6 ? A HIS 7 208 9 Y 1 A HIS -5 ? A HIS 8 209 9 Y 1 A HIS -4 ? A HIS 9 210 9 Y 1 A HIS -3 ? A HIS 10 211 9 Y 1 A SER -2 ? A SER 11 212 9 Y 1 A SER -1 ? A SER 12 213 9 Y 1 A GLY 0 ? A GLY 13 214 9 Y 1 A LYS 1 ? A LYS 14 215 9 Y 1 A LYS 2 ? A LYS 15 216 9 Y 1 A LEU 3 ? A LEU 16 217 9 Y 1 A LYS 4 ? A LYS 17 218 9 Y 1 A LYS 5 ? A LYS 18 219 9 Y 1 A GLN 6 ? A GLN 19 220 9 Y 1 A ASN 84 ? A ASN 97 221 9 Y 1 A ASP 85 ? A ASP 98 222 9 Y 1 A GLY 86 ? A GLY 99 223 9 Y 1 A GLU 87 ? A GLU 100 224 9 Y 1 A ILE 88 ? A ILE 101 225 9 Y 1 A TYR 89 ? A TYR 102 226 10 Y 1 A MET -12 ? A MET 1 227 10 Y 1 A GLY -11 ? A GLY 2 228 10 Y 1 A SER -10 ? A SER 3 229 10 Y 1 A SER -9 ? A SER 4 230 10 Y 1 A HIS -8 ? A HIS 5 231 10 Y 1 A HIS -7 ? A HIS 6 232 10 Y 1 A HIS -6 ? A HIS 7 233 10 Y 1 A HIS -5 ? A HIS 8 234 10 Y 1 A HIS -4 ? A HIS 9 235 10 Y 1 A HIS -3 ? A HIS 10 236 10 Y 1 A SER -2 ? A SER 11 237 10 Y 1 A SER -1 ? A SER 12 238 10 Y 1 A GLY 0 ? A GLY 13 239 10 Y 1 A LYS 1 ? A LYS 14 240 10 Y 1 A LYS 2 ? A LYS 15 241 10 Y 1 A LEU 3 ? A LEU 16 242 10 Y 1 A LYS 4 ? A LYS 17 243 10 Y 1 A LYS 5 ? A LYS 18 244 10 Y 1 A GLN 6 ? A GLN 19 245 10 Y 1 A ASN 84 ? A ASN 97 246 10 Y 1 A ASP 85 ? A ASP 98 247 10 Y 1 A GLY 86 ? A GLY 99 248 10 Y 1 A GLU 87 ? A GLU 100 249 10 Y 1 A ILE 88 ? A ILE 101 250 10 Y 1 A TYR 89 ? A TYR 102 251 11 Y 1 A MET -12 ? A MET 1 252 11 Y 1 A GLY -11 ? A GLY 2 253 11 Y 1 A SER -10 ? A SER 3 254 11 Y 1 A SER -9 ? A SER 4 255 11 Y 1 A HIS -8 ? A HIS 5 256 11 Y 1 A HIS -7 ? A HIS 6 257 11 Y 1 A HIS -6 ? A HIS 7 258 11 Y 1 A HIS -5 ? A HIS 8 259 11 Y 1 A HIS -4 ? A HIS 9 260 11 Y 1 A HIS -3 ? A HIS 10 261 11 Y 1 A SER -2 ? A SER 11 262 11 Y 1 A SER -1 ? A SER 12 263 11 Y 1 A GLY 0 ? A GLY 13 264 11 Y 1 A LYS 1 ? A LYS 14 265 11 Y 1 A LYS 2 ? A LYS 15 266 11 Y 1 A LEU 3 ? A LEU 16 267 11 Y 1 A LYS 4 ? A LYS 17 268 11 Y 1 A LYS 5 ? A LYS 18 269 11 Y 1 A GLN 6 ? A GLN 19 270 11 Y 1 A ASN 84 ? A ASN 97 271 11 Y 1 A ASP 85 ? A ASP 98 272 11 Y 1 A GLY 86 ? A GLY 99 273 11 Y 1 A GLU 87 ? A GLU 100 274 11 Y 1 A ILE 88 ? A ILE 101 275 11 Y 1 A TYR 89 ? A TYR 102 276 12 Y 1 A MET -12 ? A MET 1 277 12 Y 1 A GLY -11 ? A GLY 2 278 12 Y 1 A SER -10 ? A SER 3 279 12 Y 1 A SER -9 ? A SER 4 280 12 Y 1 A HIS -8 ? A HIS 5 281 12 Y 1 A HIS -7 ? A HIS 6 282 12 Y 1 A HIS -6 ? A HIS 7 283 12 Y 1 A HIS -5 ? A HIS 8 284 12 Y 1 A HIS -4 ? A HIS 9 285 12 Y 1 A HIS -3 ? A HIS 10 286 12 Y 1 A SER -2 ? A SER 11 287 12 Y 1 A SER -1 ? A SER 12 288 12 Y 1 A GLY 0 ? A GLY 13 289 12 Y 1 A LYS 1 ? A LYS 14 290 12 Y 1 A LYS 2 ? A LYS 15 291 12 Y 1 A LEU 3 ? A LEU 16 292 12 Y 1 A LYS 4 ? A LYS 17 293 12 Y 1 A LYS 5 ? A LYS 18 294 12 Y 1 A GLN 6 ? A GLN 19 295 12 Y 1 A ASN 84 ? A ASN 97 296 12 Y 1 A ASP 85 ? A ASP 98 297 12 Y 1 A GLY 86 ? A GLY 99 298 12 Y 1 A GLU 87 ? A GLU 100 299 12 Y 1 A ILE 88 ? A ILE 101 300 12 Y 1 A TYR 89 ? A TYR 102 301 13 Y 1 A MET -12 ? A MET 1 302 13 Y 1 A GLY -11 ? A GLY 2 303 13 Y 1 A SER -10 ? A SER 3 304 13 Y 1 A SER -9 ? A SER 4 305 13 Y 1 A HIS -8 ? A HIS 5 306 13 Y 1 A HIS -7 ? A HIS 6 307 13 Y 1 A HIS -6 ? A HIS 7 308 13 Y 1 A HIS -5 ? A HIS 8 309 13 Y 1 A HIS -4 ? A HIS 9 310 13 Y 1 A HIS -3 ? A HIS 10 311 13 Y 1 A SER -2 ? A SER 11 312 13 Y 1 A SER -1 ? A SER 12 313 13 Y 1 A GLY 0 ? A GLY 13 314 13 Y 1 A LYS 1 ? A LYS 14 315 13 Y 1 A LYS 2 ? A LYS 15 316 13 Y 1 A LEU 3 ? A LEU 16 317 13 Y 1 A LYS 4 ? A LYS 17 318 13 Y 1 A LYS 5 ? A LYS 18 319 13 Y 1 A GLN 6 ? A GLN 19 320 13 Y 1 A ASN 84 ? A ASN 97 321 13 Y 1 A ASP 85 ? A ASP 98 322 13 Y 1 A GLY 86 ? A GLY 99 323 13 Y 1 A GLU 87 ? A GLU 100 324 13 Y 1 A ILE 88 ? A ILE 101 325 13 Y 1 A TYR 89 ? A TYR 102 326 14 Y 1 A MET -12 ? A MET 1 327 14 Y 1 A GLY -11 ? A GLY 2 328 14 Y 1 A SER -10 ? A SER 3 329 14 Y 1 A SER -9 ? A SER 4 330 14 Y 1 A HIS -8 ? A HIS 5 331 14 Y 1 A HIS -7 ? A HIS 6 332 14 Y 1 A HIS -6 ? A HIS 7 333 14 Y 1 A HIS -5 ? A HIS 8 334 14 Y 1 A HIS -4 ? A HIS 9 335 14 Y 1 A HIS -3 ? A HIS 10 336 14 Y 1 A SER -2 ? A SER 11 337 14 Y 1 A SER -1 ? A SER 12 338 14 Y 1 A GLY 0 ? A GLY 13 339 14 Y 1 A LYS 1 ? A LYS 14 340 14 Y 1 A LYS 2 ? A LYS 15 341 14 Y 1 A LEU 3 ? A LEU 16 342 14 Y 1 A LYS 4 ? A LYS 17 343 14 Y 1 A LYS 5 ? A LYS 18 344 14 Y 1 A GLN 6 ? A GLN 19 345 14 Y 1 A ASN 84 ? A ASN 97 346 14 Y 1 A ASP 85 ? A ASP 98 347 14 Y 1 A GLY 86 ? A GLY 99 348 14 Y 1 A GLU 87 ? A GLU 100 349 14 Y 1 A ILE 88 ? A ILE 101 350 14 Y 1 A TYR 89 ? A TYR 102 351 15 Y 1 A MET -12 ? A MET 1 352 15 Y 1 A GLY -11 ? A GLY 2 353 15 Y 1 A SER -10 ? A SER 3 354 15 Y 1 A SER -9 ? A SER 4 355 15 Y 1 A HIS -8 ? A HIS 5 356 15 Y 1 A HIS -7 ? A HIS 6 357 15 Y 1 A HIS -6 ? A HIS 7 358 15 Y 1 A HIS -5 ? A HIS 8 359 15 Y 1 A HIS -4 ? A HIS 9 360 15 Y 1 A HIS -3 ? A HIS 10 361 15 Y 1 A SER -2 ? A SER 11 362 15 Y 1 A SER -1 ? A SER 12 363 15 Y 1 A GLY 0 ? A GLY 13 364 15 Y 1 A LYS 1 ? A LYS 14 365 15 Y 1 A LYS 2 ? A LYS 15 366 15 Y 1 A LEU 3 ? A LEU 16 367 15 Y 1 A LYS 4 ? A LYS 17 368 15 Y 1 A LYS 5 ? A LYS 18 369 15 Y 1 A GLN 6 ? A GLN 19 370 15 Y 1 A ASN 84 ? A ASN 97 371 15 Y 1 A ASP 85 ? A ASP 98 372 15 Y 1 A GLY 86 ? A GLY 99 373 15 Y 1 A GLU 87 ? A GLU 100 374 15 Y 1 A ILE 88 ? A ILE 101 375 15 Y 1 A TYR 89 ? A TYR 102 376 16 Y 1 A MET -12 ? A MET 1 377 16 Y 1 A GLY -11 ? A GLY 2 378 16 Y 1 A SER -10 ? A SER 3 379 16 Y 1 A SER -9 ? A SER 4 380 16 Y 1 A HIS -8 ? A HIS 5 381 16 Y 1 A HIS -7 ? A HIS 6 382 16 Y 1 A HIS -6 ? A HIS 7 383 16 Y 1 A HIS -5 ? A HIS 8 384 16 Y 1 A HIS -4 ? A HIS 9 385 16 Y 1 A HIS -3 ? A HIS 10 386 16 Y 1 A SER -2 ? A SER 11 387 16 Y 1 A SER -1 ? A SER 12 388 16 Y 1 A GLY 0 ? A GLY 13 389 16 Y 1 A LYS 1 ? A LYS 14 390 16 Y 1 A LYS 2 ? A LYS 15 391 16 Y 1 A LEU 3 ? A LEU 16 392 16 Y 1 A LYS 4 ? A LYS 17 393 16 Y 1 A LYS 5 ? A LYS 18 394 16 Y 1 A GLN 6 ? A GLN 19 395 16 Y 1 A ASN 84 ? A ASN 97 396 16 Y 1 A ASP 85 ? A ASP 98 397 16 Y 1 A GLY 86 ? A GLY 99 398 16 Y 1 A GLU 87 ? A GLU 100 399 16 Y 1 A ILE 88 ? A ILE 101 400 16 Y 1 A TYR 89 ? A TYR 102 401 17 Y 1 A MET -12 ? A MET 1 402 17 Y 1 A GLY -11 ? A GLY 2 403 17 Y 1 A SER -10 ? A SER 3 404 17 Y 1 A SER -9 ? A SER 4 405 17 Y 1 A HIS -8 ? A HIS 5 406 17 Y 1 A HIS -7 ? A HIS 6 407 17 Y 1 A HIS -6 ? A HIS 7 408 17 Y 1 A HIS -5 ? A HIS 8 409 17 Y 1 A HIS -4 ? A HIS 9 410 17 Y 1 A HIS -3 ? A HIS 10 411 17 Y 1 A SER -2 ? A SER 11 412 17 Y 1 A SER -1 ? A SER 12 413 17 Y 1 A GLY 0 ? A GLY 13 414 17 Y 1 A LYS 1 ? A LYS 14 415 17 Y 1 A LYS 2 ? A LYS 15 416 17 Y 1 A LEU 3 ? A LEU 16 417 17 Y 1 A LYS 4 ? A LYS 17 418 17 Y 1 A LYS 5 ? A LYS 18 419 17 Y 1 A GLN 6 ? A GLN 19 420 17 Y 1 A ASN 84 ? A ASN 97 421 17 Y 1 A ASP 85 ? A ASP 98 422 17 Y 1 A GLY 86 ? A GLY 99 423 17 Y 1 A GLU 87 ? A GLU 100 424 17 Y 1 A ILE 88 ? A ILE 101 425 17 Y 1 A TYR 89 ? A TYR 102 426 18 Y 1 A MET -12 ? A MET 1 427 18 Y 1 A GLY -11 ? A GLY 2 428 18 Y 1 A SER -10 ? A SER 3 429 18 Y 1 A SER -9 ? A SER 4 430 18 Y 1 A HIS -8 ? A HIS 5 431 18 Y 1 A HIS -7 ? A HIS 6 432 18 Y 1 A HIS -6 ? A HIS 7 433 18 Y 1 A HIS -5 ? A HIS 8 434 18 Y 1 A HIS -4 ? A HIS 9 435 18 Y 1 A HIS -3 ? A HIS 10 436 18 Y 1 A SER -2 ? A SER 11 437 18 Y 1 A SER -1 ? A SER 12 438 18 Y 1 A GLY 0 ? A GLY 13 439 18 Y 1 A LYS 1 ? A LYS 14 440 18 Y 1 A LYS 2 ? A LYS 15 441 18 Y 1 A LEU 3 ? A LEU 16 442 18 Y 1 A LYS 4 ? A LYS 17 443 18 Y 1 A LYS 5 ? A LYS 18 444 18 Y 1 A GLN 6 ? A GLN 19 445 18 Y 1 A ASN 84 ? A ASN 97 446 18 Y 1 A ASP 85 ? A ASP 98 447 18 Y 1 A GLY 86 ? A GLY 99 448 18 Y 1 A GLU 87 ? A GLU 100 449 18 Y 1 A ILE 88 ? A ILE 101 450 18 Y 1 A TYR 89 ? A TYR 102 451 19 Y 1 A MET -12 ? A MET 1 452 19 Y 1 A GLY -11 ? A GLY 2 453 19 Y 1 A SER -10 ? A SER 3 454 19 Y 1 A SER -9 ? A SER 4 455 19 Y 1 A HIS -8 ? A HIS 5 456 19 Y 1 A HIS -7 ? A HIS 6 457 19 Y 1 A HIS -6 ? A HIS 7 458 19 Y 1 A HIS -5 ? A HIS 8 459 19 Y 1 A HIS -4 ? A HIS 9 460 19 Y 1 A HIS -3 ? A HIS 10 461 19 Y 1 A SER -2 ? A SER 11 462 19 Y 1 A SER -1 ? A SER 12 463 19 Y 1 A GLY 0 ? A GLY 13 464 19 Y 1 A LYS 1 ? A LYS 14 465 19 Y 1 A LYS 2 ? A LYS 15 466 19 Y 1 A LEU 3 ? A LEU 16 467 19 Y 1 A LYS 4 ? A LYS 17 468 19 Y 1 A LYS 5 ? A LYS 18 469 19 Y 1 A GLN 6 ? A GLN 19 470 19 Y 1 A ASN 84 ? A ASN 97 471 19 Y 1 A ASP 85 ? A ASP 98 472 19 Y 1 A GLY 86 ? A GLY 99 473 19 Y 1 A GLU 87 ? A GLU 100 474 19 Y 1 A ILE 88 ? A ILE 101 475 19 Y 1 A TYR 89 ? A TYR 102 476 20 Y 1 A MET -12 ? A MET 1 477 20 Y 1 A GLY -11 ? A GLY 2 478 20 Y 1 A SER -10 ? A SER 3 479 20 Y 1 A SER -9 ? A SER 4 480 20 Y 1 A HIS -8 ? A HIS 5 481 20 Y 1 A HIS -7 ? A HIS 6 482 20 Y 1 A HIS -6 ? A HIS 7 483 20 Y 1 A HIS -5 ? A HIS 8 484 20 Y 1 A HIS -4 ? A HIS 9 485 20 Y 1 A HIS -3 ? A HIS 10 486 20 Y 1 A SER -2 ? A SER 11 487 20 Y 1 A SER -1 ? A SER 12 488 20 Y 1 A GLY 0 ? A GLY 13 489 20 Y 1 A LYS 1 ? A LYS 14 490 20 Y 1 A LYS 2 ? A LYS 15 491 20 Y 1 A LEU 3 ? A LEU 16 492 20 Y 1 A LYS 4 ? A LYS 17 493 20 Y 1 A LYS 5 ? A LYS 18 494 20 Y 1 A GLN 6 ? A GLN 19 495 20 Y 1 A ASN 84 ? A ASN 97 496 20 Y 1 A ASP 85 ? A ASP 98 497 20 Y 1 A GLY 86 ? A GLY 99 498 20 Y 1 A GLU 87 ? A GLU 100 499 20 Y 1 A ILE 88 ? A ILE 101 500 20 Y 1 A TYR 89 ? A TYR 102 #