data_1RQ8 # _entry.id 1RQ8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1RQ8 pdb_00001rq8 10.2210/pdb1rq8/pdb RCSB RCSB020946 ? ? WWPDB D_1000020946 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-07-06 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1RQ8 _pdbx_database_status.recvd_initial_deposition_date 2003-12-04 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, D.' 1 'Wyss, D.F.' 2 # _citation.id primary _citation.title 'Solution Structure of the Hypothetical Protein SAV1595 from Staphylococcus Aureus, a Putative RNA Binding Protein.' _citation.journal_abbrev J.Biomol.Nmr _citation.journal_volume 29 _citation.page_first 391 _citation.page_last 394 _citation.year 2004 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15213438 _citation.pdbx_database_id_DOI 10.1023/B:JNMR.0000032524.62229.93 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, D.' 1 ? primary 'Wyss, D.F.' 2 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'conserved hypothetical protein' _entity.formula_weight 12167.879 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'homologous to YhbY of E.coli.' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MLTGKQKRYLRSLAHNIDPIFQIGKGGINENMIKQIDDTLENRELIKVHVLQNNFDDKKELAETLSEATRSELVQVIGSM IVIYRESKENKEIELPLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MLTGKQKRYLRSLAHNIDPIFQIGKGGINENMIKQIDDTLENRELIKVHVLQNNFDDKKELAETLSEATRSELVQVIGSM IVIYRESKENKEIELPLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 THR n 1 4 GLY n 1 5 LYS n 1 6 GLN n 1 7 LYS n 1 8 ARG n 1 9 TYR n 1 10 LEU n 1 11 ARG n 1 12 SER n 1 13 LEU n 1 14 ALA n 1 15 HIS n 1 16 ASN n 1 17 ILE n 1 18 ASP n 1 19 PRO n 1 20 ILE n 1 21 PHE n 1 22 GLN n 1 23 ILE n 1 24 GLY n 1 25 LYS n 1 26 GLY n 1 27 GLY n 1 28 ILE n 1 29 ASN n 1 30 GLU n 1 31 ASN n 1 32 MET n 1 33 ILE n 1 34 LYS n 1 35 GLN n 1 36 ILE n 1 37 ASP n 1 38 ASP n 1 39 THR n 1 40 LEU n 1 41 GLU n 1 42 ASN n 1 43 ARG n 1 44 GLU n 1 45 LEU n 1 46 ILE n 1 47 LYS n 1 48 VAL n 1 49 HIS n 1 50 VAL n 1 51 LEU n 1 52 GLN n 1 53 ASN n 1 54 ASN n 1 55 PHE n 1 56 ASP n 1 57 ASP n 1 58 LYS n 1 59 LYS n 1 60 GLU n 1 61 LEU n 1 62 ALA n 1 63 GLU n 1 64 THR n 1 65 LEU n 1 66 SER n 1 67 GLU n 1 68 ALA n 1 69 THR n 1 70 ARG n 1 71 SER n 1 72 GLU n 1 73 LEU n 1 74 VAL n 1 75 GLN n 1 76 VAL n 1 77 ILE n 1 78 GLY n 1 79 SER n 1 80 MET n 1 81 ILE n 1 82 VAL n 1 83 ILE n 1 84 TYR n 1 85 ARG n 1 86 GLU n 1 87 SER n 1 88 LYS n 1 89 GLU n 1 90 ASN n 1 91 LYS n 1 92 GLU n 1 93 ILE n 1 94 GLU n 1 95 LEU n 1 96 PRO n 1 97 LEU n 1 98 GLU n 1 99 HIS n 1 100 HIS n 1 101 HIS n 1 102 HIS n 1 103 HIS n 1 104 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Staphylococcus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1280 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 LEU 97 97 ? ? ? A . n A 1 98 GLU 98 98 ? ? ? A . n A 1 99 HIS 99 99 ? ? ? A . n A 1 100 HIS 100 100 ? ? ? A . n A 1 101 HIS 101 101 ? ? ? A . n A 1 102 HIS 102 102 ? ? ? A . n A 1 103 HIS 103 103 ? ? ? A . n A 1 104 HIS 104 104 ? ? ? A . n # _exptl.entry_id 1RQ8 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1RQ8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1RQ8 _struct.title 'Solution structure of the hypothetical protein SAV1595 from Staphylococcus aureus, a putative RNA binding protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1RQ8 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text 'STRUCTURAL GENOMICS, SAV1595, YhbY, UPF0044, UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q99TQ4_STAAM _struct_ref.pdbx_db_accession Q99TQ4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLTGKQKRYLRSLAHNIDPIFQIGKGGINENMIKQIDDTLENRELIKVHVLQNNFDDKKELAETLSEATRSELVQVIGSM IVIYRESKENKEIELP ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1RQ8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 96 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99TQ4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 96 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 96 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1RQ8 LEU A 97 ? UNP Q99TQ4 ? ? 'expression tag' 97 1 1 1RQ8 GLU A 98 ? UNP Q99TQ4 ? ? 'expression tag' 98 2 1 1RQ8 HIS A 99 ? UNP Q99TQ4 ? ? 'expression tag' 99 3 1 1RQ8 HIS A 100 ? UNP Q99TQ4 ? ? 'expression tag' 100 4 1 1RQ8 HIS A 101 ? UNP Q99TQ4 ? ? 'expression tag' 101 5 1 1RQ8 HIS A 102 ? UNP Q99TQ4 ? ? 'expression tag' 102 6 1 1RQ8 HIS A 103 ? UNP Q99TQ4 ? ? 'expression tag' 103 7 1 1RQ8 HIS A 104 ? UNP Q99TQ4 ? ? 'expression tag' 104 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 3 ? ALA A 14 ? THR A 3 ALA A 14 1 ? 12 HELX_P HELX_P2 2 ASN A 29 ? ARG A 43 ? ASN A 29 ARG A 43 1 ? 15 HELX_P HELX_P3 3 ASN A 54 ? ARG A 70 ? ASN A 54 ARG A 70 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 22 ? ILE A 23 ? GLN A 22 ILE A 23 A 2 LEU A 45 ? VAL A 50 ? LEU A 45 VAL A 50 A 3 MET A 80 ? ARG A 85 ? MET A 80 ARG A 85 A 4 SER A 71 ? ILE A 77 ? SER A 71 ILE A 77 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 23 ? N ILE A 23 O HIS A 49 ? O HIS A 49 A 2 3 N VAL A 48 ? N VAL A 48 O ILE A 81 ? O ILE A 81 A 3 4 O VAL A 82 ? O VAL A 82 N GLN A 75 ? N GLN A 75 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ILE 33 ? ? H A ASP 37 ? ? 1.53 2 1 O A LEU 61 ? ? H A LEU 65 ? ? 1.53 3 1 O A VAL 48 ? ? H A ILE 81 ? ? 1.54 4 1 O A GLN 75 ? ? H A VAL 82 ? ? 1.55 5 1 O A LEU 40 ? ? HE A ARG 85 ? ? 1.56 6 1 O A GLU 30 ? ? H A LYS 34 ? ? 1.58 7 1 O A LYS 7 ? ? H A ARG 11 ? ? 1.59 8 2 O A ILE 33 ? ? H A ASP 37 ? ? 1.56 9 2 H A ILE 23 ? ? O A HIS 49 ? ? 1.57 10 2 O A ALA 62 ? ? H A SER 66 ? ? 1.58 11 2 O A VAL 48 ? ? H A ILE 81 ? ? 1.58 12 2 O A LYS 7 ? ? H A ARG 11 ? ? 1.59 13 2 O A GLU 30 ? ? H A LYS 34 ? ? 1.60 14 3 O A LYS 7 ? ? H A ARG 11 ? ? 1.56 15 3 O A VAL 48 ? ? H A ILE 81 ? ? 1.58 16 3 O A GLN 75 ? ? H A VAL 82 ? ? 1.59 17 4 O A GLN 75 ? ? H A VAL 82 ? ? 1.54 18 4 O A ILE 33 ? ? H A ASP 37 ? ? 1.56 19 4 O A ALA 62 ? ? H A SER 66 ? ? 1.58 20 4 O A LYS 7 ? ? H A ARG 11 ? ? 1.58 21 4 O A GLU 30 ? ? H A LYS 34 ? ? 1.60 22 5 O A ALA 62 ? ? H A SER 66 ? ? 1.56 23 5 O A GLN 75 ? ? H A VAL 82 ? ? 1.56 24 5 O A VAL 48 ? ? H A ILE 81 ? ? 1.59 25 5 O A LYS 7 ? ? H A ARG 11 ? ? 1.59 26 6 O A VAL 48 ? ? H A ILE 81 ? ? 1.55 27 6 O A GLN 75 ? ? H A VAL 82 ? ? 1.56 28 6 O A ILE 77 ? ? H A MET 80 ? ? 1.57 29 6 O A LYS 7 ? ? H A ARG 11 ? ? 1.60 30 7 O A LEU 61 ? ? H A LEU 65 ? ? 1.51 31 7 O A ILE 33 ? ? H A ASP 37 ? ? 1.57 32 7 O A GLU 30 ? ? H A LYS 34 ? ? 1.58 33 7 O A GLN 75 ? ? H A VAL 82 ? ? 1.59 34 8 O A VAL 48 ? ? H A ILE 81 ? ? 1.55 35 8 O A ALA 62 ? ? H A SER 66 ? ? 1.57 36 8 O A ILE 33 ? ? H A ASP 37 ? ? 1.59 37 8 O A GLU 30 ? ? H A LYS 34 ? ? 1.60 38 9 O A LEU 65 ? ? H A THR 69 ? ? 1.53 39 9 O A VAL 48 ? ? H A ILE 81 ? ? 1.53 40 9 H A ILE 23 ? ? O A HIS 49 ? ? 1.54 41 9 O A GLN 75 ? ? H A VAL 82 ? ? 1.55 42 9 O A ILE 33 ? ? H A ASP 37 ? ? 1.57 43 10 O A MET 32 ? ? H A ILE 36 ? ? 1.55 44 10 O A GLN 75 ? ? H A VAL 82 ? ? 1.55 45 10 O A LYS 7 ? ? H A ARG 11 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 53 ? ? 66.38 -60.50 2 1 GLN A 75 ? ? 175.96 168.16 3 1 GLU A 86 ? ? -37.23 169.42 4 1 LYS A 88 ? ? -146.73 -48.03 5 1 ASN A 90 ? ? -57.25 81.28 6 1 GLU A 92 ? ? -64.69 75.72 7 1 LEU A 95 ? ? -173.06 65.52 8 2 LEU A 51 ? ? -86.46 34.42 9 2 SER A 71 ? ? -117.37 -167.37 10 2 GLN A 75 ? ? 171.73 179.03 11 2 GLU A 86 ? ? 30.97 -149.05 12 2 LYS A 88 ? ? -141.74 -58.80 13 2 ASN A 90 ? ? -57.45 81.66 14 2 LYS A 91 ? ? -100.01 -166.92 15 3 LEU A 51 ? ? -86.24 40.03 16 3 GLN A 75 ? ? 176.76 -177.64 17 3 GLU A 86 ? ? -41.29 174.22 18 3 LYS A 88 ? ? -148.15 -48.22 19 3 ASN A 90 ? ? -54.17 83.81 20 3 GLU A 92 ? ? -64.54 74.00 21 3 LEU A 95 ? ? -175.83 69.55 22 4 ARG A 43 ? ? -106.35 -158.82 23 4 GLU A 44 ? ? -121.82 -57.21 24 4 ASN A 53 ? ? 59.80 14.22 25 4 PHE A 55 ? ? -82.35 -70.71 26 4 GLU A 86 ? ? 24.01 -144.93 27 4 LYS A 88 ? ? -152.59 -62.27 28 4 ASN A 90 ? ? -62.09 78.03 29 4 GLU A 92 ? ? -65.15 74.23 30 4 LEU A 95 ? ? -168.90 65.05 31 5 ARG A 43 ? ? 79.68 -153.39 32 5 GLU A 44 ? ? 73.75 -146.60 33 5 PHE A 55 ? ? -77.44 -84.99 34 5 GLN A 75 ? ? 178.30 -174.06 35 5 GLU A 86 ? ? 18.65 -145.14 36 5 LYS A 88 ? ? -156.28 -63.96 37 5 ASN A 90 ? ? -60.39 77.37 38 5 GLU A 92 ? ? -65.26 71.89 39 5 LEU A 95 ? ? -176.14 65.93 40 6 LEU A 51 ? ? -88.74 44.15 41 6 ASN A 53 ? ? 63.95 -73.76 42 6 SER A 71 ? ? -121.43 -167.29 43 6 GLN A 75 ? ? 179.14 170.33 44 6 SER A 79 ? ? 71.86 -1.13 45 6 GLU A 86 ? ? 27.28 -146.10 46 6 LYS A 88 ? ? -150.82 -62.20 47 6 ASN A 90 ? ? -60.05 80.45 48 6 GLU A 92 ? ? -64.77 73.53 49 6 LEU A 95 ? ? -164.75 62.64 50 7 ASN A 53 ? ? 65.83 -59.16 51 7 GLN A 75 ? ? 171.26 169.56 52 7 GLU A 86 ? ? -38.89 168.08 53 7 LYS A 88 ? ? -144.37 -49.53 54 7 ASN A 90 ? ? -54.86 85.62 55 7 GLU A 92 ? ? -64.72 78.20 56 7 LEU A 95 ? ? -170.71 72.30 57 8 LEU A 51 ? ? -83.06 36.91 58 8 SER A 71 ? ? -114.54 -166.58 59 8 GLN A 75 ? ? 173.79 176.96 60 8 GLU A 86 ? ? -38.78 167.94 61 8 LYS A 88 ? ? -141.60 -50.31 62 8 ASN A 90 ? ? -54.41 83.91 63 8 GLU A 92 ? ? -64.56 76.82 64 8 LEU A 95 ? ? -144.61 -53.58 65 9 LEU A 51 ? ? -89.47 36.73 66 9 ASN A 53 ? ? 58.81 15.90 67 9 SER A 71 ? ? -124.04 -163.03 68 9 GLN A 75 ? ? 175.81 -179.91 69 9 GLU A 86 ? ? 14.65 -143.15 70 9 LYS A 88 ? ? -156.33 -68.61 71 9 ASN A 90 ? ? -58.85 78.31 72 9 GLU A 92 ? ? -65.57 71.26 73 9 LEU A 95 ? ? -172.30 -65.80 74 10 PRO A 19 ? ? -59.83 92.92 75 10 ARG A 43 ? ? -84.35 -139.16 76 10 GLU A 44 ? ? -143.61 -60.47 77 10 ASN A 53 ? ? 65.19 -68.92 78 10 GLN A 75 ? ? 173.24 -177.07 79 10 GLU A 86 ? ? -40.08 171.31 80 10 LYS A 88 ? ? -141.32 -48.79 81 10 ASN A 90 ? ? -51.77 85.54 82 10 GLU A 92 ? ? -64.79 75.94 83 10 LEU A 95 ? ? -154.52 -70.13 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 8 ? ? 0.187 'SIDE CHAIN' 2 1 ARG A 11 ? ? 0.195 'SIDE CHAIN' 3 1 ARG A 43 ? ? 0.279 'SIDE CHAIN' 4 1 ARG A 70 ? ? 0.317 'SIDE CHAIN' 5 1 ARG A 85 ? ? 0.314 'SIDE CHAIN' 6 2 ARG A 8 ? ? 0.317 'SIDE CHAIN' 7 2 ARG A 11 ? ? 0.224 'SIDE CHAIN' 8 2 ARG A 43 ? ? 0.238 'SIDE CHAIN' 9 2 ARG A 70 ? ? 0.164 'SIDE CHAIN' 10 2 ARG A 85 ? ? 0.210 'SIDE CHAIN' 11 3 ARG A 8 ? ? 0.203 'SIDE CHAIN' 12 3 ARG A 11 ? ? 0.300 'SIDE CHAIN' 13 3 ARG A 43 ? ? 0.302 'SIDE CHAIN' 14 3 ARG A 70 ? ? 0.228 'SIDE CHAIN' 15 3 ARG A 85 ? ? 0.298 'SIDE CHAIN' 16 4 ARG A 8 ? ? 0.234 'SIDE CHAIN' 17 4 ARG A 11 ? ? 0.309 'SIDE CHAIN' 18 4 ARG A 43 ? ? 0.278 'SIDE CHAIN' 19 4 ARG A 70 ? ? 0.310 'SIDE CHAIN' 20 4 ARG A 85 ? ? 0.251 'SIDE CHAIN' 21 5 ARG A 8 ? ? 0.183 'SIDE CHAIN' 22 5 ARG A 11 ? ? 0.250 'SIDE CHAIN' 23 5 ARG A 43 ? ? 0.317 'SIDE CHAIN' 24 5 ARG A 70 ? ? 0.237 'SIDE CHAIN' 25 5 ARG A 85 ? ? 0.316 'SIDE CHAIN' 26 6 ARG A 8 ? ? 0.267 'SIDE CHAIN' 27 6 ARG A 11 ? ? 0.274 'SIDE CHAIN' 28 6 ARG A 43 ? ? 0.305 'SIDE CHAIN' 29 6 ARG A 70 ? ? 0.247 'SIDE CHAIN' 30 6 ARG A 85 ? ? 0.192 'SIDE CHAIN' 31 7 ARG A 8 ? ? 0.271 'SIDE CHAIN' 32 7 ARG A 11 ? ? 0.303 'SIDE CHAIN' 33 7 ARG A 43 ? ? 0.308 'SIDE CHAIN' 34 7 ARG A 70 ? ? 0.316 'SIDE CHAIN' 35 7 ARG A 85 ? ? 0.214 'SIDE CHAIN' 36 8 ARG A 8 ? ? 0.279 'SIDE CHAIN' 37 8 ARG A 11 ? ? 0.264 'SIDE CHAIN' 38 8 ARG A 43 ? ? 0.270 'SIDE CHAIN' 39 8 ARG A 70 ? ? 0.209 'SIDE CHAIN' 40 8 ARG A 85 ? ? 0.150 'SIDE CHAIN' 41 9 ARG A 8 ? ? 0.251 'SIDE CHAIN' 42 9 ARG A 11 ? ? 0.316 'SIDE CHAIN' 43 9 ARG A 43 ? ? 0.289 'SIDE CHAIN' 44 9 ARG A 70 ? ? 0.205 'SIDE CHAIN' 45 9 ARG A 85 ? ? 0.199 'SIDE CHAIN' 46 10 ARG A 8 ? ? 0.291 'SIDE CHAIN' 47 10 ARG A 11 ? ? 0.292 'SIDE CHAIN' 48 10 ARG A 43 ? ? 0.148 'SIDE CHAIN' 49 10 ARG A 70 ? ? 0.220 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1RQ8 _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1RQ8 _pdbx_nmr_representative.conformer_id 10 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM SAV1595, U-15N,13C; 75 mM phosphate buffer, 8%D2O' _pdbx_nmr_sample_details.solvent_system '92%H2O, 8%D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.45 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_refine.entry_id 1RQ8 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 98 'structure solution' Accelrys 1 X-PLOR 98 refinement Accelrys 2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 97 ? A LEU 97 2 1 Y 1 A GLU 98 ? A GLU 98 3 1 Y 1 A HIS 99 ? A HIS 99 4 1 Y 1 A HIS 100 ? A HIS 100 5 1 Y 1 A HIS 101 ? A HIS 101 6 1 Y 1 A HIS 102 ? A HIS 102 7 1 Y 1 A HIS 103 ? A HIS 103 8 1 Y 1 A HIS 104 ? A HIS 104 9 2 Y 1 A LEU 97 ? A LEU 97 10 2 Y 1 A GLU 98 ? A GLU 98 11 2 Y 1 A HIS 99 ? A HIS 99 12 2 Y 1 A HIS 100 ? A HIS 100 13 2 Y 1 A HIS 101 ? A HIS 101 14 2 Y 1 A HIS 102 ? A HIS 102 15 2 Y 1 A HIS 103 ? A HIS 103 16 2 Y 1 A HIS 104 ? A HIS 104 17 3 Y 1 A LEU 97 ? A LEU 97 18 3 Y 1 A GLU 98 ? A GLU 98 19 3 Y 1 A HIS 99 ? A HIS 99 20 3 Y 1 A HIS 100 ? A HIS 100 21 3 Y 1 A HIS 101 ? A HIS 101 22 3 Y 1 A HIS 102 ? A HIS 102 23 3 Y 1 A HIS 103 ? A HIS 103 24 3 Y 1 A HIS 104 ? A HIS 104 25 4 Y 1 A LEU 97 ? A LEU 97 26 4 Y 1 A GLU 98 ? A GLU 98 27 4 Y 1 A HIS 99 ? A HIS 99 28 4 Y 1 A HIS 100 ? A HIS 100 29 4 Y 1 A HIS 101 ? A HIS 101 30 4 Y 1 A HIS 102 ? A HIS 102 31 4 Y 1 A HIS 103 ? A HIS 103 32 4 Y 1 A HIS 104 ? A HIS 104 33 5 Y 1 A LEU 97 ? A LEU 97 34 5 Y 1 A GLU 98 ? A GLU 98 35 5 Y 1 A HIS 99 ? A HIS 99 36 5 Y 1 A HIS 100 ? A HIS 100 37 5 Y 1 A HIS 101 ? A HIS 101 38 5 Y 1 A HIS 102 ? A HIS 102 39 5 Y 1 A HIS 103 ? A HIS 103 40 5 Y 1 A HIS 104 ? A HIS 104 41 6 Y 1 A LEU 97 ? A LEU 97 42 6 Y 1 A GLU 98 ? A GLU 98 43 6 Y 1 A HIS 99 ? A HIS 99 44 6 Y 1 A HIS 100 ? A HIS 100 45 6 Y 1 A HIS 101 ? A HIS 101 46 6 Y 1 A HIS 102 ? A HIS 102 47 6 Y 1 A HIS 103 ? A HIS 103 48 6 Y 1 A HIS 104 ? A HIS 104 49 7 Y 1 A LEU 97 ? A LEU 97 50 7 Y 1 A GLU 98 ? A GLU 98 51 7 Y 1 A HIS 99 ? A HIS 99 52 7 Y 1 A HIS 100 ? A HIS 100 53 7 Y 1 A HIS 101 ? A HIS 101 54 7 Y 1 A HIS 102 ? A HIS 102 55 7 Y 1 A HIS 103 ? A HIS 103 56 7 Y 1 A HIS 104 ? A HIS 104 57 8 Y 1 A LEU 97 ? A LEU 97 58 8 Y 1 A GLU 98 ? A GLU 98 59 8 Y 1 A HIS 99 ? A HIS 99 60 8 Y 1 A HIS 100 ? A HIS 100 61 8 Y 1 A HIS 101 ? A HIS 101 62 8 Y 1 A HIS 102 ? A HIS 102 63 8 Y 1 A HIS 103 ? A HIS 103 64 8 Y 1 A HIS 104 ? A HIS 104 65 9 Y 1 A LEU 97 ? A LEU 97 66 9 Y 1 A GLU 98 ? A GLU 98 67 9 Y 1 A HIS 99 ? A HIS 99 68 9 Y 1 A HIS 100 ? A HIS 100 69 9 Y 1 A HIS 101 ? A HIS 101 70 9 Y 1 A HIS 102 ? A HIS 102 71 9 Y 1 A HIS 103 ? A HIS 103 72 9 Y 1 A HIS 104 ? A HIS 104 73 10 Y 1 A LEU 97 ? A LEU 97 74 10 Y 1 A GLU 98 ? A GLU 98 75 10 Y 1 A HIS 99 ? A HIS 99 76 10 Y 1 A HIS 100 ? A HIS 100 77 10 Y 1 A HIS 101 ? A HIS 101 78 10 Y 1 A HIS 102 ? A HIS 102 79 10 Y 1 A HIS 103 ? A HIS 103 80 10 Y 1 A HIS 104 ? A HIS 104 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 600 # _atom_sites.entry_id 1RQ8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_