data_1RQU # _entry.id 1RQU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1RQU pdb_00001rqu 10.2210/pdb1rqu/pdb RCSB RCSB020968 ? ? WWPDB D_1000020968 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type BMRB 4429 . unspecified PDB 1RQS . unspecified PDB 1RQT . unspecified PDB 1RQV . unspecified PDB 1DD3 . unspecified PDB 1DD4 . unspecified PDB 1CTF . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1RQU _pdbx_database_status.recvd_initial_deposition_date 2003-12-07 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bocharov, E.V.' 1 'Sobol, A.G.' 2 'Pavlov, K.V.' 3 'Korzhnev, D.M.' 4 'Jaravine, V.A.' 5 'Gudkov, A.T.' 6 'Arseniev, A.S.' 7 # _citation.id primary _citation.title 'From structure and dynamics of protein L7/L12 to molecular switching in ribosome.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 279 _citation.page_first 17697 _citation.page_last 17706 _citation.year 2004 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 14960595 _citation.pdbx_database_id_DOI 10.1074/jbc.M313384200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bocharov, E.V.' 1 ? primary 'Sobol, A.G.' 2 ? primary 'Pavlov, K.V.' 3 ? primary 'Korzhnev, D.M.' 4 ? primary 'Jaravine, V.A.' 5 ? primary 'Gudkov, A.T.' 6 ? primary 'Arseniev, A.S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description '50S ribosomal protein L7/L12' _entity.formula_weight 12177.960 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'L7 dimer' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name L8 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGL KEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEVK ; _entity_poly.pdbx_seq_one_letter_code_can ;SITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGL KEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEVK ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ILE n 1 3 THR n 1 4 LYS n 1 5 ASP n 1 6 GLN n 1 7 ILE n 1 8 ILE n 1 9 GLU n 1 10 ALA n 1 11 VAL n 1 12 ALA n 1 13 ALA n 1 14 MET n 1 15 SER n 1 16 VAL n 1 17 MET n 1 18 ASP n 1 19 VAL n 1 20 VAL n 1 21 GLU n 1 22 LEU n 1 23 ILE n 1 24 SER n 1 25 ALA n 1 26 MET n 1 27 GLU n 1 28 GLU n 1 29 LYS n 1 30 PHE n 1 31 GLY n 1 32 VAL n 1 33 SER n 1 34 ALA n 1 35 ALA n 1 36 ALA n 1 37 ALA n 1 38 VAL n 1 39 ALA n 1 40 VAL n 1 41 ALA n 1 42 ALA n 1 43 GLY n 1 44 PRO n 1 45 VAL n 1 46 GLU n 1 47 ALA n 1 48 ALA n 1 49 GLU n 1 50 GLU n 1 51 LYS n 1 52 THR n 1 53 GLU n 1 54 PHE n 1 55 ASP n 1 56 VAL n 1 57 ILE n 1 58 LEU n 1 59 LYS n 1 60 ALA n 1 61 ALA n 1 62 GLY n 1 63 ALA n 1 64 ASN n 1 65 LYS n 1 66 VAL n 1 67 ALA n 1 68 VAL n 1 69 ILE n 1 70 LYS n 1 71 ALA n 1 72 VAL n 1 73 ARG n 1 74 GLY n 1 75 ALA n 1 76 THR n 1 77 GLY n 1 78 LEU n 1 79 GLY n 1 80 LEU n 1 81 LYS n 1 82 GLU n 1 83 ALA n 1 84 LYS n 1 85 ASP n 1 86 LEU n 1 87 VAL n 1 88 GLU n 1 89 SER n 1 90 ALA n 1 91 PRO n 1 92 ALA n 1 93 ALA n 1 94 LEU n 1 95 LYS n 1 96 GLU n 1 97 GLY n 1 98 VAL n 1 99 SER n 1 100 LYS n 1 101 ASP n 1 102 ASP n 1 103 ALA n 1 104 GLU n 1 105 ALA n 1 106 LEU n 1 107 LYS n 1 108 LYS n 1 109 ALA n 1 110 LEU n 1 111 GLU n 1 112 GLU n 1 113 ALA n 1 114 GLY n 1 115 ALA n 1 116 GLU n 1 117 VAL n 1 118 GLU n 1 119 VAL n 1 120 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain XL1 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pPR1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RL7_ECOLI _struct_ref.pdbx_db_accession P0A7K2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGL KEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEVK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1RQU A 1 ? 120 ? P0A7K2 1 ? 120 ? 1 120 2 1 1RQU B 1 ? 120 ? P0A7K2 1 ? 120 ? 1 120 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 2 1 '2D NOESY' 3 1 1 3D_15N-HNHB 4 1 1 15N-HMQCJ 5 3 1 15N-JNH_modulated_HSQC # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.9 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.15 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM L7 dimer U-15N; 50mM phosphate buffer; 90% H2O, 10% D2O; 30 C' '90% H2O/10% D2O' 2 '1mM L7 dimer U-15N; 50mM phosphate buffer; 99.9% D2O; 30 C' '99.9% D2O' 3 '1mM L7 dimer U-15N; 50mM phosphate buffer; 90% H2O, 10% D2O; 30 C; Tobacco virus alignment medium' '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model UNITY _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1RQU _pdbx_nmr_refine.method 'simulated annealing combined with molecular dynamics in torsion angle space' _pdbx_nmr_refine.details ;Representative structure of L7 dimer with two unordered and extended hinge regions was calculated using the mean structures of its N- and C-terminal domains and NMR derived constraints obtained for U-15N protein L7 ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1RQU _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_ensemble.entry_id 1RQU _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1RQU _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR 6.3b collection 'VARIAN USA' 1 XEASY 1.2.11 'data analysis' 'Bartels, C.' 2 CYANA 1.01 'structure solution' 'Guntert, P.' 3 FANTOM 4 refinement 'Schaumann, T.' 4 # _exptl.entry_id 1RQU _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1RQU _struct.title 'NMR structure of L7 dimer from E.coli' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1RQU _struct_keywords.pdbx_keywords RIBOSOME _struct_keywords.text 'protein L7/L12, ribosome' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 3 ? ALA A 12 ? THR A 3 ALA A 12 1 ? 10 HELX_P HELX_P2 2 SER A 15 ? PHE A 30 ? SER A 15 PHE A 30 1 ? 16 HELX_P HELX_P3 3 ASN A 64 ? THR A 76 ? ASN A 64 THR A 76 1 ? 13 HELX_P HELX_P4 4 GLY A 79 ? SER A 89 ? GLY A 79 SER A 89 1 ? 11 HELX_P HELX_P5 5 SER A 99 ? GLY A 114 ? SER A 99 GLY A 114 1 ? 16 HELX_P HELX_P6 6 THR B 3 ? ALA B 12 ? THR B 3 ALA B 12 1 ? 10 HELX_P HELX_P7 7 SER B 15 ? PHE B 30 ? SER B 15 PHE B 30 1 ? 16 HELX_P HELX_P8 8 ASN B 64 ? THR B 76 ? ASN B 64 THR B 76 1 ? 13 HELX_P HELX_P9 9 GLY B 79 ? SER B 89 ? GLY B 79 SER B 89 1 ? 11 HELX_P HELX_P10 10 SER B 99 ? GLY B 114 ? SER B 99 GLY B 114 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ALA 90 A . ? ALA 90 A PRO 91 A ? PRO 91 A 1 -0.19 2 ALA 90 B . ? ALA 90 B PRO 91 B ? PRO 91 B 1 -0.23 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 92 ? VAL A 98 ? ALA A 92 VAL A 98 A 2 PHE A 54 ? ALA A 60 ? PHE A 54 ALA A 60 A 3 GLU A 116 ? LYS A 120 ? GLU A 116 LYS A 120 B 1 ALA B 92 ? VAL B 98 ? ALA B 92 VAL B 98 B 2 PHE B 54 ? ALA B 60 ? PHE B 54 ALA B 60 B 3 GLU B 116 ? LYS B 120 ? GLU B 116 LYS B 120 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ALA A 92 ? O ALA A 92 N LEU A 58 ? N LEU A 58 A 2 3 N ILE A 57 ? N ILE A 57 O GLU A 118 ? O GLU A 118 B 1 2 O VAL B 98 ? O VAL B 98 N PHE B 54 ? N PHE B 54 B 2 3 N ASP B 55 ? N ASP B 55 O LYS B 120 ? O LYS B 120 # _database_PDB_matrix.entry_id 1RQU _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1RQU _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 LYS 120 120 120 LYS LYS A . n B 1 1 SER 1 1 1 SER SER B . n B 1 2 ILE 2 2 2 ILE ILE B . n B 1 3 THR 3 3 3 THR THR B . n B 1 4 LYS 4 4 4 LYS LYS B . n B 1 5 ASP 5 5 5 ASP ASP B . n B 1 6 GLN 6 6 6 GLN GLN B . n B 1 7 ILE 7 7 7 ILE ILE B . n B 1 8 ILE 8 8 8 ILE ILE B . n B 1 9 GLU 9 9 9 GLU GLU B . n B 1 10 ALA 10 10 10 ALA ALA B . n B 1 11 VAL 11 11 11 VAL VAL B . n B 1 12 ALA 12 12 12 ALA ALA B . n B 1 13 ALA 13 13 13 ALA ALA B . n B 1 14 MET 14 14 14 MET MET B . n B 1 15 SER 15 15 15 SER SER B . n B 1 16 VAL 16 16 16 VAL VAL B . n B 1 17 MET 17 17 17 MET MET B . n B 1 18 ASP 18 18 18 ASP ASP B . n B 1 19 VAL 19 19 19 VAL VAL B . n B 1 20 VAL 20 20 20 VAL VAL B . n B 1 21 GLU 21 21 21 GLU GLU B . n B 1 22 LEU 22 22 22 LEU LEU B . n B 1 23 ILE 23 23 23 ILE ILE B . n B 1 24 SER 24 24 24 SER SER B . n B 1 25 ALA 25 25 25 ALA ALA B . n B 1 26 MET 26 26 26 MET MET B . n B 1 27 GLU 27 27 27 GLU GLU B . n B 1 28 GLU 28 28 28 GLU GLU B . n B 1 29 LYS 29 29 29 LYS LYS B . n B 1 30 PHE 30 30 30 PHE PHE B . n B 1 31 GLY 31 31 31 GLY GLY B . n B 1 32 VAL 32 32 32 VAL VAL B . n B 1 33 SER 33 33 33 SER SER B . n B 1 34 ALA 34 34 34 ALA ALA B . n B 1 35 ALA 35 35 35 ALA ALA B . n B 1 36 ALA 36 36 36 ALA ALA B . n B 1 37 ALA 37 37 37 ALA ALA B . n B 1 38 VAL 38 38 38 VAL VAL B . n B 1 39 ALA 39 39 39 ALA ALA B . n B 1 40 VAL 40 40 40 VAL VAL B . n B 1 41 ALA 41 41 41 ALA ALA B . n B 1 42 ALA 42 42 42 ALA ALA B . n B 1 43 GLY 43 43 43 GLY GLY B . n B 1 44 PRO 44 44 44 PRO PRO B . n B 1 45 VAL 45 45 45 VAL VAL B . n B 1 46 GLU 46 46 46 GLU GLU B . n B 1 47 ALA 47 47 47 ALA ALA B . n B 1 48 ALA 48 48 48 ALA ALA B . n B 1 49 GLU 49 49 49 GLU GLU B . n B 1 50 GLU 50 50 50 GLU GLU B . n B 1 51 LYS 51 51 51 LYS LYS B . n B 1 52 THR 52 52 52 THR THR B . n B 1 53 GLU 53 53 53 GLU GLU B . n B 1 54 PHE 54 54 54 PHE PHE B . n B 1 55 ASP 55 55 55 ASP ASP B . n B 1 56 VAL 56 56 56 VAL VAL B . n B 1 57 ILE 57 57 57 ILE ILE B . n B 1 58 LEU 58 58 58 LEU LEU B . n B 1 59 LYS 59 59 59 LYS LYS B . n B 1 60 ALA 60 60 60 ALA ALA B . n B 1 61 ALA 61 61 61 ALA ALA B . n B 1 62 GLY 62 62 62 GLY GLY B . n B 1 63 ALA 63 63 63 ALA ALA B . n B 1 64 ASN 64 64 64 ASN ASN B . n B 1 65 LYS 65 65 65 LYS LYS B . n B 1 66 VAL 66 66 66 VAL VAL B . n B 1 67 ALA 67 67 67 ALA ALA B . n B 1 68 VAL 68 68 68 VAL VAL B . n B 1 69 ILE 69 69 69 ILE ILE B . n B 1 70 LYS 70 70 70 LYS LYS B . n B 1 71 ALA 71 71 71 ALA ALA B . n B 1 72 VAL 72 72 72 VAL VAL B . n B 1 73 ARG 73 73 73 ARG ARG B . n B 1 74 GLY 74 74 74 GLY GLY B . n B 1 75 ALA 75 75 75 ALA ALA B . n B 1 76 THR 76 76 76 THR THR B . n B 1 77 GLY 77 77 77 GLY GLY B . n B 1 78 LEU 78 78 78 LEU LEU B . n B 1 79 GLY 79 79 79 GLY GLY B . n B 1 80 LEU 80 80 80 LEU LEU B . n B 1 81 LYS 81 81 81 LYS LYS B . n B 1 82 GLU 82 82 82 GLU GLU B . n B 1 83 ALA 83 83 83 ALA ALA B . n B 1 84 LYS 84 84 84 LYS LYS B . n B 1 85 ASP 85 85 85 ASP ASP B . n B 1 86 LEU 86 86 86 LEU LEU B . n B 1 87 VAL 87 87 87 VAL VAL B . n B 1 88 GLU 88 88 88 GLU GLU B . n B 1 89 SER 89 89 89 SER SER B . n B 1 90 ALA 90 90 90 ALA ALA B . n B 1 91 PRO 91 91 91 PRO PRO B . n B 1 92 ALA 92 92 92 ALA ALA B . n B 1 93 ALA 93 93 93 ALA ALA B . n B 1 94 LEU 94 94 94 LEU LEU B . n B 1 95 LYS 95 95 95 LYS LYS B . n B 1 96 GLU 96 96 96 GLU GLU B . n B 1 97 GLY 97 97 97 GLY GLY B . n B 1 98 VAL 98 98 98 VAL VAL B . n B 1 99 SER 99 99 99 SER SER B . n B 1 100 LYS 100 100 100 LYS LYS B . n B 1 101 ASP 101 101 101 ASP ASP B . n B 1 102 ASP 102 102 102 ASP ASP B . n B 1 103 ALA 103 103 103 ALA ALA B . n B 1 104 GLU 104 104 104 GLU GLU B . n B 1 105 ALA 105 105 105 ALA ALA B . n B 1 106 LEU 106 106 106 LEU LEU B . n B 1 107 LYS 107 107 107 LYS LYS B . n B 1 108 LYS 108 108 108 LYS LYS B . n B 1 109 ALA 109 109 109 ALA ALA B . n B 1 110 LEU 110 110 110 LEU LEU B . n B 1 111 GLU 111 111 111 GLU GLU B . n B 1 112 GLU 112 112 112 GLU GLU B . n B 1 113 ALA 113 113 113 ALA ALA B . n B 1 114 GLY 114 114 114 GLY GLY B . n B 1 115 ALA 115 115 115 ALA ALA B . n B 1 116 GLU 116 116 116 GLU GLU B . n B 1 117 VAL 117 117 117 VAL VAL B . n B 1 118 GLU 118 118 118 GLU GLU B . n B 1 119 VAL 119 119 119 VAL VAL B . n B 1 120 LYS 120 120 120 LYS LYS B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-03-02 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 2 ? ? -97.79 57.65 2 1 ALA A 34 ? ? -95.39 50.91 3 1 ALA A 35 ? ? -41.29 98.66 4 1 ALA A 36 ? ? -174.20 -52.73 5 1 ALA A 37 ? ? 62.76 146.26 6 1 ALA A 39 ? ? -171.15 -53.73 7 1 VAL A 40 ? ? 62.58 109.88 8 1 ALA A 41 ? ? 176.86 129.03 9 1 ALA A 47 ? ? -50.08 176.36 10 1 ALA A 48 ? ? 62.35 61.57 11 1 LYS A 59 ? ? -93.13 -60.09 12 1 ALA A 63 ? ? -92.54 39.58 13 1 ASN A 64 ? ? -153.87 56.49 14 1 VAL A 72 ? ? -59.29 -77.77 15 1 THR A 76 ? ? -115.74 -74.96 16 1 ILE B 2 ? ? -117.67 65.05 17 1 VAL B 32 ? ? -94.59 42.44 18 1 ALA B 34 ? ? 175.03 82.66 19 1 ALA B 36 ? ? 53.16 179.13 20 1 VAL B 40 ? ? -150.74 -62.02 21 1 ALA B 41 ? ? -100.41 -60.45 22 1 ALA B 42 ? ? 64.28 86.39 23 1 ALA B 47 ? ? -47.27 169.94 24 1 ALA B 48 ? ? 75.66 58.01 25 1 LYS B 59 ? ? -93.05 -60.07 26 1 ALA B 63 ? ? -92.65 39.71 27 1 ASN B 64 ? ? -154.30 56.56 28 1 VAL B 72 ? ? -59.31 -77.34 29 1 THR B 76 ? ? -115.91 -75.03 #