data_1RWD # _entry.id 1RWD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1RWD pdb_00001rwd 10.2210/pdb1rwd/pdb RCSB RCSB021090 ? ? WWPDB D_1000021090 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2003-12-23 _pdbx_database_PDB_obs_spr.pdb_id 1RWD _pdbx_database_PDB_obs_spr.replace_pdb_id 1M2Y _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1M2Y ;Same protein, structure was calculated with an interactive, as opposed to automated, residue assembly procedure. Subsequent refinement by minimization used an incomplete restraint set. ; unspecified TargetDB Pfu-1210573-001 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1RWD _pdbx_database_status.recvd_initial_deposition_date 2003-12-16 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tian, F.' 1 'Valafar, H.' 2 'Prestegard, J.H.' 3 'Southeast Collaboratory for Structural Genomics (SECSG)' 4 # _citation.id primary _citation.title 'A Dipolar Coupling Based Strategy for Simultaneous Resonance Assignment and Structure Determination of Protein Backbones' _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 123 _citation.page_first 11791 _citation.page_last 11796 _citation.year 2001 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 0002-7863 _citation.journal_id_CSD 0004 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11716736 _citation.pdbx_database_id_DOI 10.1021/ja011806h # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tian, F.' 1 ? primary 'Valafar, H.' 2 ? primary 'Prestegard, J.H.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Rubredoxin _entity.formula_weight 5863.470 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'W3Y, I23V, L32I' _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Rd # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AKYVCKICGYIYDEDAGDPDNGVSPGTKFEEIPDDWVCPICGAPKSEFEKLED _entity_poly.pdbx_seq_one_letter_code_can AKYVCKICGYIYDEDAGDPDNGVSPGTKFEEIPDDWVCPICGAPKSEFEKLED _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier Pfu-1210573-001 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 LYS n 1 3 TYR n 1 4 VAL n 1 5 CYS n 1 6 LYS n 1 7 ILE n 1 8 CYS n 1 9 GLY n 1 10 TYR n 1 11 ILE n 1 12 TYR n 1 13 ASP n 1 14 GLU n 1 15 ASP n 1 16 ALA n 1 17 GLY n 1 18 ASP n 1 19 PRO n 1 20 ASP n 1 21 ASN n 1 22 GLY n 1 23 VAL n 1 24 SER n 1 25 PRO n 1 26 GLY n 1 27 THR n 1 28 LYS n 1 29 PHE n 1 30 GLU n 1 31 GLU n 1 32 ILE n 1 33 PRO n 1 34 ASP n 1 35 ASP n 1 36 TRP n 1 37 VAL n 1 38 CYS n 1 39 PRO n 1 40 ILE n 1 41 CYS n 1 42 GLY n 1 43 ALA n 1 44 PRO n 1 45 LYS n 1 46 SER n 1 47 GLU n 1 48 PHE n 1 49 GLU n 1 50 LYS n 1 51 LEU n 1 52 GLU n 1 53 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pyrococcus _entity_src_gen.pdbx_gene_src_gene 'RUB, PF1282' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus furiosus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2261 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain NCM533 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PTRC99A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RUBR_PYRFU _struct_ref.pdbx_db_accession P24297 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1RWD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 53 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P24297 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 53 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 53 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1RWD TYR A 3 ? UNP P24297 TRP 3 'engineered mutation' 3 1 1 1RWD VAL A 23 ? UNP P24297 ILE 23 'engineered mutation' 23 2 1 1RWD ILE A 32 ? UNP P24297 LEU 32 'engineered mutation' 32 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 'soft HNCA-E.COSY' 2 1 1 'modified HNCO' 3 1 1 'phase-modulated HSQC' 4 2 2 'soft HNCA-E.COSY' 5 2 2 'modified HNCO' 6 2 2 'phase-modulated HSQC' 7 3 1 'soft HNCA-E.COSY' 8 3 1 'modified HNCO' 9 3 1 'phase-modulated HSQC' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 ambient 6.3 '100 mM NaCl' ? K 2 298 ambient 6.3 '50 mM NaCl' ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '4.5 mM Rubredoxin U-15N; 50 mM Na Phosphate; 100 mM NaCl; pH 6.3' '90% H2O/10% D2O' 2 '2.5 mM Rubredoxin U-15N; 50 mM Na Phosphate ; 50 mM NaCl; pH 6.3; 7% Bicelle (3:1 DMPC:DHPC with 4% CTAB relative to DMPC)' 'Bicelles in 90% H2O, 10% D2O' 3 '4.5 mM Rubredoxin U-15N; 50 mM Na Phosphate; 100 mM NaCl; pH 6.3; PF1 phage sample' 'Phage in 90% H2O, 10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 500 2 ? Varian INOVA 800 # _pdbx_nmr_refine.entry_id 1RWD _pdbx_nmr_refine.method 'RDC directed fragment assembly' _pdbx_nmr_refine.details ;RDCs were used in the initial assembly of 6 fragments. RDCs from two media were used to set relative orientation of fragments. Translational relationships of fragments were dictated by sequence connectivities. The assembled structure was minimized using a molecular force field and RDC error function. All sidechain atoms beyond CB are missing. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1RWD _pdbx_nmr_details.text ;Structure was determined using residual dipolar couplings from backbone atom pairs; modeled as an Ala-Gly polypeptide ; # _pdbx_nmr_ensemble.entry_id 1RWD _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1RWD _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal REDcRAFT 1.0 'structure solution' 'Valafar, H. & Prestegard, J.H.' 1 XPLOR-NIH 2.9.1 refinement 'Schwieters, C.D., Kuszewski, J.J., Tjandra, N. & Clore, G.M.' 2 REDCAT 1.0 'data analysis' 'Valafar, H. & Prestegard, J.H.' 3 # _exptl.entry_id 1RWD _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1RWD _struct.title 'Backbone NMR Structure of a Mutant P. Furiosus Rubredoxin Using Residual Dipolar Couplings' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1RWD _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text ;residual dipolar couplings, structural genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, ELECTRON TRANSPORT ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 18 ? GLY A 22 ? ASP A 18 GLY A 22 5 ? 5 HELX_P HELX_P2 2 LYS A 28 ? ILE A 32 ? LYS A 28 ILE A 32 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1RWD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1RWD _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 LEU 51 51 ? ? ? A . n A 1 52 GLU 52 52 ? ? ? A . n A 1 53 ASP 53 53 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Southeast Collaboratory for Structural Genomics' _pdbx_SG_project.initial_of_center SECSG # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-12-23 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 C _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 LYS _pdbx_validate_rmsd_bond.auth_seq_id_1 28 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 N _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 PHE _pdbx_validate_rmsd_bond.auth_seq_id_2 29 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.197 _pdbx_validate_rmsd_bond.bond_target_value 1.336 _pdbx_validate_rmsd_bond.bond_deviation -0.139 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.023 _pdbx_validate_rmsd_bond.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 7 ? ? -98.20 -66.33 2 1 TYR A 10 ? ? -25.69 144.14 3 1 TYR A 12 ? ? -75.80 34.07 4 1 ASP A 13 ? ? -35.01 97.93 5 1 ASP A 18 ? ? -158.04 71.82 6 1 GLU A 30 ? ? -68.59 12.30 7 1 ILE A 40 ? ? -89.70 -74.65 8 1 GLU A 47 ? ? -70.14 38.36 # _pdbx_validate_polymer_linkage.id 1 _pdbx_validate_polymer_linkage.PDB_model_num 1 _pdbx_validate_polymer_linkage.auth_atom_id_1 C _pdbx_validate_polymer_linkage.auth_asym_id_1 A _pdbx_validate_polymer_linkage.auth_comp_id_1 LYS _pdbx_validate_polymer_linkage.auth_seq_id_1 28 _pdbx_validate_polymer_linkage.PDB_ins_code_1 ? _pdbx_validate_polymer_linkage.label_alt_id_1 ? _pdbx_validate_polymer_linkage.auth_atom_id_2 N _pdbx_validate_polymer_linkage.auth_asym_id_2 A _pdbx_validate_polymer_linkage.auth_comp_id_2 PHE _pdbx_validate_polymer_linkage.auth_seq_id_2 29 _pdbx_validate_polymer_linkage.PDB_ins_code_2 ? _pdbx_validate_polymer_linkage.label_alt_id_2 ? _pdbx_validate_polymer_linkage.dist 1.20 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 2 ? CG ? A LYS 2 CG 2 1 Y 1 A LYS 2 ? CD ? A LYS 2 CD 3 1 Y 1 A LYS 2 ? CE ? A LYS 2 CE 4 1 Y 1 A LYS 2 ? NZ ? A LYS 2 NZ 5 1 Y 1 A TYR 3 ? CG ? A TYR 3 CG 6 1 Y 1 A TYR 3 ? CD1 ? A TYR 3 CD1 7 1 Y 1 A TYR 3 ? CD2 ? A TYR 3 CD2 8 1 Y 1 A TYR 3 ? CE1 ? A TYR 3 CE1 9 1 Y 1 A TYR 3 ? CE2 ? A TYR 3 CE2 10 1 Y 1 A TYR 3 ? CZ ? A TYR 3 CZ 11 1 Y 1 A TYR 3 ? OH ? A TYR 3 OH 12 1 Y 1 A VAL 4 ? CG1 ? A VAL 4 CG1 13 1 Y 1 A VAL 4 ? CG2 ? A VAL 4 CG2 14 1 Y 1 A CYS 5 ? SG ? A CYS 5 SG 15 1 Y 1 A LYS 6 ? CG ? A LYS 6 CG 16 1 Y 1 A LYS 6 ? CD ? A LYS 6 CD 17 1 Y 1 A LYS 6 ? CE ? A LYS 6 CE 18 1 Y 1 A LYS 6 ? NZ ? A LYS 6 NZ 19 1 Y 1 A ILE 7 ? CG1 ? A ILE 7 CG1 20 1 Y 1 A ILE 7 ? CG2 ? A ILE 7 CG2 21 1 Y 1 A ILE 7 ? CD1 ? A ILE 7 CD1 22 1 Y 1 A CYS 8 ? SG ? A CYS 8 SG 23 1 Y 1 A TYR 10 ? CG ? A TYR 10 CG 24 1 Y 1 A TYR 10 ? CD1 ? A TYR 10 CD1 25 1 Y 1 A TYR 10 ? CD2 ? A TYR 10 CD2 26 1 Y 1 A TYR 10 ? CE1 ? A TYR 10 CE1 27 1 Y 1 A TYR 10 ? CE2 ? A TYR 10 CE2 28 1 Y 1 A TYR 10 ? CZ ? A TYR 10 CZ 29 1 Y 1 A TYR 10 ? OH ? A TYR 10 OH 30 1 Y 1 A ILE 11 ? CG1 ? A ILE 11 CG1 31 1 Y 1 A ILE 11 ? CG2 ? A ILE 11 CG2 32 1 Y 1 A ILE 11 ? CD1 ? A ILE 11 CD1 33 1 Y 1 A TYR 12 ? CG ? A TYR 12 CG 34 1 Y 1 A TYR 12 ? CD1 ? A TYR 12 CD1 35 1 Y 1 A TYR 12 ? CD2 ? A TYR 12 CD2 36 1 Y 1 A TYR 12 ? CE1 ? A TYR 12 CE1 37 1 Y 1 A TYR 12 ? CE2 ? A TYR 12 CE2 38 1 Y 1 A TYR 12 ? CZ ? A TYR 12 CZ 39 1 Y 1 A TYR 12 ? OH ? A TYR 12 OH 40 1 Y 1 A ASP 13 ? CG ? A ASP 13 CG 41 1 Y 1 A ASP 13 ? OD1 ? A ASP 13 OD1 42 1 Y 1 A ASP 13 ? OD2 ? A ASP 13 OD2 43 1 Y 1 A GLU 14 ? CG ? A GLU 14 CG 44 1 Y 1 A GLU 14 ? CD ? A GLU 14 CD 45 1 Y 1 A GLU 14 ? OE1 ? A GLU 14 OE1 46 1 Y 1 A GLU 14 ? OE2 ? A GLU 14 OE2 47 1 Y 1 A ASP 15 ? CG ? A ASP 15 CG 48 1 Y 1 A ASP 15 ? OD1 ? A ASP 15 OD1 49 1 Y 1 A ASP 15 ? OD2 ? A ASP 15 OD2 50 1 Y 1 A ASP 18 ? CG ? A ASP 18 CG 51 1 Y 1 A ASP 18 ? OD1 ? A ASP 18 OD1 52 1 Y 1 A ASP 18 ? OD2 ? A ASP 18 OD2 53 1 Y 1 A PRO 19 ? CG ? A PRO 19 CG 54 1 Y 1 A PRO 19 ? CD ? A PRO 19 CD 55 1 Y 1 A ASP 20 ? CG ? A ASP 20 CG 56 1 Y 1 A ASP 20 ? OD1 ? A ASP 20 OD1 57 1 Y 1 A ASP 20 ? OD2 ? A ASP 20 OD2 58 1 Y 1 A ASN 21 ? CG ? A ASN 21 CG 59 1 Y 1 A ASN 21 ? OD1 ? A ASN 21 OD1 60 1 Y 1 A ASN 21 ? ND2 ? A ASN 21 ND2 61 1 Y 1 A VAL 23 ? CG1 ? A VAL 23 CG1 62 1 Y 1 A VAL 23 ? CG2 ? A VAL 23 CG2 63 1 Y 1 A SER 24 ? OG ? A SER 24 OG 64 1 Y 1 A PRO 25 ? CG ? A PRO 25 CG 65 1 Y 1 A PRO 25 ? CD ? A PRO 25 CD 66 1 Y 1 A THR 27 ? OG1 ? A THR 27 OG1 67 1 Y 1 A THR 27 ? CG2 ? A THR 27 CG2 68 1 Y 1 A LYS 28 ? CG ? A LYS 28 CG 69 1 Y 1 A LYS 28 ? CD ? A LYS 28 CD 70 1 Y 1 A LYS 28 ? CE ? A LYS 28 CE 71 1 Y 1 A LYS 28 ? NZ ? A LYS 28 NZ 72 1 Y 1 A PHE 29 ? CG ? A PHE 29 CG 73 1 Y 1 A PHE 29 ? CD1 ? A PHE 29 CD1 74 1 Y 1 A PHE 29 ? CD2 ? A PHE 29 CD2 75 1 Y 1 A PHE 29 ? CE1 ? A PHE 29 CE1 76 1 Y 1 A PHE 29 ? CE2 ? A PHE 29 CE2 77 1 Y 1 A PHE 29 ? CZ ? A PHE 29 CZ 78 1 Y 1 A GLU 30 ? CG ? A GLU 30 CG 79 1 Y 1 A GLU 30 ? CD ? A GLU 30 CD 80 1 Y 1 A GLU 30 ? OE1 ? A GLU 30 OE1 81 1 Y 1 A GLU 30 ? OE2 ? A GLU 30 OE2 82 1 Y 1 A GLU 31 ? CG ? A GLU 31 CG 83 1 Y 1 A GLU 31 ? CD ? A GLU 31 CD 84 1 Y 1 A GLU 31 ? OE1 ? A GLU 31 OE1 85 1 Y 1 A GLU 31 ? OE2 ? A GLU 31 OE2 86 1 Y 1 A ILE 32 ? CG1 ? A ILE 32 CG1 87 1 Y 1 A ILE 32 ? CG2 ? A ILE 32 CG2 88 1 Y 1 A ILE 32 ? CD1 ? A ILE 32 CD1 89 1 Y 1 A PRO 33 ? CG ? A PRO 33 CG 90 1 Y 1 A PRO 33 ? CD ? A PRO 33 CD 91 1 Y 1 A ASP 34 ? CG ? A ASP 34 CG 92 1 Y 1 A ASP 34 ? OD1 ? A ASP 34 OD1 93 1 Y 1 A ASP 34 ? OD2 ? A ASP 34 OD2 94 1 Y 1 A ASP 35 ? CG ? A ASP 35 CG 95 1 Y 1 A ASP 35 ? OD1 ? A ASP 35 OD1 96 1 Y 1 A ASP 35 ? OD2 ? A ASP 35 OD2 97 1 Y 1 A TRP 36 ? CG ? A TRP 36 CG 98 1 Y 1 A TRP 36 ? CD1 ? A TRP 36 CD1 99 1 Y 1 A TRP 36 ? CD2 ? A TRP 36 CD2 100 1 Y 1 A TRP 36 ? NE1 ? A TRP 36 NE1 101 1 Y 1 A TRP 36 ? CE2 ? A TRP 36 CE2 102 1 Y 1 A TRP 36 ? CE3 ? A TRP 36 CE3 103 1 Y 1 A TRP 36 ? CZ2 ? A TRP 36 CZ2 104 1 Y 1 A TRP 36 ? CZ3 ? A TRP 36 CZ3 105 1 Y 1 A TRP 36 ? CH2 ? A TRP 36 CH2 106 1 Y 1 A VAL 37 ? CG1 ? A VAL 37 CG1 107 1 Y 1 A VAL 37 ? CG2 ? A VAL 37 CG2 108 1 Y 1 A CYS 38 ? SG ? A CYS 38 SG 109 1 Y 1 A PRO 39 ? CG ? A PRO 39 CG 110 1 Y 1 A PRO 39 ? CD ? A PRO 39 CD 111 1 Y 1 A ILE 40 ? CG1 ? A ILE 40 CG1 112 1 Y 1 A ILE 40 ? CG2 ? A ILE 40 CG2 113 1 Y 1 A ILE 40 ? CD1 ? A ILE 40 CD1 114 1 Y 1 A CYS 41 ? SG ? A CYS 41 SG 115 1 Y 1 A PRO 44 ? CG ? A PRO 44 CG 116 1 Y 1 A PRO 44 ? CD ? A PRO 44 CD 117 1 Y 1 A LYS 45 ? CG ? A LYS 45 CG 118 1 Y 1 A LYS 45 ? CD ? A LYS 45 CD 119 1 Y 1 A LYS 45 ? CE ? A LYS 45 CE 120 1 Y 1 A LYS 45 ? NZ ? A LYS 45 NZ 121 1 Y 1 A SER 46 ? OG ? A SER 46 OG 122 1 Y 1 A GLU 47 ? CG ? A GLU 47 CG 123 1 Y 1 A GLU 47 ? CD ? A GLU 47 CD 124 1 Y 1 A GLU 47 ? OE1 ? A GLU 47 OE1 125 1 Y 1 A GLU 47 ? OE2 ? A GLU 47 OE2 126 1 Y 1 A PHE 48 ? CG ? A PHE 48 CG 127 1 Y 1 A PHE 48 ? CD1 ? A PHE 48 CD1 128 1 Y 1 A PHE 48 ? CD2 ? A PHE 48 CD2 129 1 Y 1 A PHE 48 ? CE1 ? A PHE 48 CE1 130 1 Y 1 A PHE 48 ? CE2 ? A PHE 48 CE2 131 1 Y 1 A PHE 48 ? CZ ? A PHE 48 CZ 132 1 Y 1 A GLU 49 ? CG ? A GLU 49 CG 133 1 Y 1 A GLU 49 ? CD ? A GLU 49 CD 134 1 Y 1 A GLU 49 ? OE1 ? A GLU 49 OE1 135 1 Y 1 A GLU 49 ? OE2 ? A GLU 49 OE2 136 1 Y 1 A LYS 50 ? CG ? A LYS 50 CG 137 1 Y 1 A LYS 50 ? CD ? A LYS 50 CD 138 1 Y 1 A LYS 50 ? CE ? A LYS 50 CE 139 1 Y 1 A LYS 50 ? NZ ? A LYS 50 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 51 ? A LEU 51 2 1 Y 1 A GLU 52 ? A GLU 52 3 1 Y 1 A ASP 53 ? A ASP 53 #