data_1RZL # _entry.id 1RZL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1RZL pdb_00001rzl 10.2210/pdb1rzl/pdb WWPDB D_1000176277 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1RZL _pdbx_database_status.recvd_initial_deposition_date 1997-10-09 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lee, J.Y.' 1 'Min, K.S.' 2 'Cha, H.' 3 'Shin, D.H.' 4 'Hwang, K.Y.' 5 'Suh, S.W.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Rice non-specific lipid transfer protein: the 1.6 A crystal structure in the unliganded state reveals a small hydrophobic cavity.' J.Mol.Biol. 276 437 448 1998 JMOBAK UK 0022-2836 0070 ? 9512714 10.1006/jmbi.1997.1550 1 'Crystallization and Preliminary X-Ray Crystallographic Analysis of Probable Amylase/Protease Inhibitor-B from Rice Seeds' J.Mol.Biol. 229 255 ? 1993 JMOBAK UK 0022-2836 0070 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lee, J.Y.' 1 ? primary 'Min, K.' 2 ? primary 'Cha, H.' 3 ? primary 'Shin, D.H.' 4 ? primary 'Hwang, K.Y.' 5 ? primary 'Suh, S.W.' 6 ? 1 'Hwang, K.Y.' 7 ? 1 'Kim, K.K.' 8 ? 1 'Min, K.' 9 ? 1 'Eom, S.H.' 10 ? 1 'Yu, Y.G.' 11 ? 1 'Kim, S.' 12 ? 1 'Sweet, R.M.' 13 ? 1 'Suh, S.W.' 14 ? # _cell.entry_id 1RZL _cell.length_a 37.930 _cell.length_b 37.930 _cell.length_c 97.870 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1RZL _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'NONSPECIFIC LIPID TRANSFER PROTEIN' 8919.187 1 ? ? 'FOUR-HELIX BUNDLE' ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 non-polymer syn '3-CYCLOHEXYL-1-PROPYLSULFONIC ACID' 221.317 2 ? ? ? ? 4 water nat water 18.015 68 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYT ISASIDCSRVS ; _entity_poly.pdbx_seq_one_letter_code_can ;ITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYT ISASIDCSRVS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 THR n 1 3 CYS n 1 4 GLY n 1 5 GLN n 1 6 VAL n 1 7 ASN n 1 8 SER n 1 9 ALA n 1 10 VAL n 1 11 GLY n 1 12 PRO n 1 13 CYS n 1 14 LEU n 1 15 THR n 1 16 TYR n 1 17 ALA n 1 18 ARG n 1 19 GLY n 1 20 GLY n 1 21 ALA n 1 22 GLY n 1 23 PRO n 1 24 SER n 1 25 ALA n 1 26 ALA n 1 27 CYS n 1 28 CYS n 1 29 SER n 1 30 GLY n 1 31 VAL n 1 32 ARG n 1 33 SER n 1 34 LEU n 1 35 LYS n 1 36 ALA n 1 37 ALA n 1 38 ALA n 1 39 SER n 1 40 THR n 1 41 THR n 1 42 ALA n 1 43 ASP n 1 44 ARG n 1 45 ARG n 1 46 THR n 1 47 ALA n 1 48 CYS n 1 49 ASN n 1 50 CYS n 1 51 LEU n 1 52 LYS n 1 53 ASN n 1 54 ALA n 1 55 ALA n 1 56 ARG n 1 57 GLY n 1 58 ILE n 1 59 LYS n 1 60 GLY n 1 61 LEU n 1 62 ASN n 1 63 ALA n 1 64 GLY n 1 65 ASN n 1 66 ALA n 1 67 ALA n 1 68 SER n 1 69 ILE n 1 70 PRO n 1 71 SER n 1 72 LYS n 1 73 CYS n 1 74 GLY n 1 75 VAL n 1 76 SER n 1 77 VAL n 1 78 PRO n 1 79 TYR n 1 80 THR n 1 81 ILE n 1 82 SER n 1 83 ALA n 1 84 SER n 1 85 ILE n 1 86 ASP n 1 87 CYS n 1 88 SER n 1 89 ARG n 1 90 VAL n 1 91 SER n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name rice _entity_src_nat.pdbx_organism_scientific 'Oryza sativa' _entity_src_nat.pdbx_ncbi_taxonomy_id 4530 _entity_src_nat.genus Oryza _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ SEED _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NLTP1_ORYSA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P23096 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;ITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYT ISASIDCSRVS ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1RZL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 91 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P23096 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 91 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 91 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CXS non-polymer . '3-CYCLOHEXYL-1-PROPYLSULFONIC ACID' ? 'C9 H19 N O3 S' 221.317 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1RZL _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 5 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.99 _exptl_crystal.density_percent_sol 38.2 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.8 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 7.8' # _diffrn.id 1 _diffrn.ambient_temp 290 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector DIFFRACTOMETER _diffrn_detector.type 'ENRAF-NONIUS FAST' _diffrn_detector.pdbx_collection_date 1992-05-05 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH2R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1RZL _reflns.observed_criterion_sigma_I 0.5 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50 _reflns.d_resolution_high 1.6 _reflns.number_obs 9447 _reflns.number_all ? _reflns.percent_possible_obs 94.7 _reflns.pdbx_Rmerge_I_obs 0.055 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.5 _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.6 _reflns_shell.d_res_low 1.67 _reflns_shell.percent_possible_all 79.1 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1RZL _refine.ls_number_reflns_obs 9394 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 8.0 _refine.ls_d_res_high 1.6 _refine.ls_percent_reflns_obs 94.2 _refine.ls_R_factor_obs 0.186 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.186 _refine.ls_R_factor_R_free 0.239 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 8 _refine.ls_number_reflns_R_free 993 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 20. _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 1MZL _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1RZL _refine_analyze.Luzzati_coordinate_error_obs 0.18 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs 8 _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 616 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.number_atoms_solvent 68 _refine_hist.number_atoms_total 717 _refine_hist.d_res_high 1.6 _refine_hist.d_res_low 8.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.017 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.76 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 21.6 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.77 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.d_res_high 1.6 _refine_ls_shell.d_res_low 1.67 _refine_ls_shell.number_reflns_R_work 863 _refine_ls_shell.R_factor_R_work 0.272 _refine_ls_shell.percent_reflns_obs 78.5 _refine_ls_shell.R_factor_R_free 0.293 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free 12 _refine_ls_shell.number_reflns_R_free 92 _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 RLTP.PAR RLTP.TOP 'X-RAY DIFFRACTION' 2 ? ? 'X-RAY DIFFRACTION' # _struct.entry_id 1RZL _struct.title 'RICE NONSPECIFIC LIPID TRANSFER PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1RZL _struct_keywords.pdbx_keywords 'LIPID TRANSPORT' _struct_keywords.text 'LIPID TRANSPORT, ALPHA-HELICAL STRUCTURE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 3 ? ALA A 17 ? CYS A 3 ALA A 17 1 ? 15 HELX_P HELX_P2 2 ALA A 25 ? ALA A 37 ? ALA A 25 ALA A 37 1 ? 13 HELX_P HELX_P3 3 THR A 41 ? ARG A 56 ? THR A 41 ARG A 56 1 ? 16 HELX_P HELX_P4 4 ALA A 63 ? CYS A 73 ? ALA A 63 CYS A 73 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 50 SG ? ? A CYS 3 A CYS 50 1_555 ? ? ? ? ? ? ? 2.024 ? ? disulf2 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 13 A CYS 27 1_555 ? ? ? ? ? ? ? 2.008 ? ? disulf3 disulf ? ? A CYS 28 SG ? ? ? 1_555 A CYS 73 SG ? ? A CYS 28 A CYS 73 1_555 ? ? ? ? ? ? ? 2.023 ? ? disulf4 disulf ? ? A CYS 48 SG ? ? ? 1_555 A CYS 87 SG ? ? A CYS 48 A CYS 87 1_555 ? ? ? ? ? ? ? 2.013 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 22 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 22 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 23 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 23 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.50 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 216 ? 8 'BINDING SITE FOR RESIDUE SO4 A 216' AC2 Software A CXS 201 ? 9 'BINDING SITE FOR RESIDUE CXS A 201' AC3 Software A CXS 211 ? 8 'BINDING SITE FOR RESIDUE CXS A 211' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 THR A 2 ? THR A 2 . ? 1_555 ? 2 AC1 8 GLY A 4 ? GLY A 4 . ? 1_555 ? 3 AC1 8 SER A 24 ? SER A 24 . ? 7_556 ? 4 AC1 8 ALA A 26 ? ALA A 26 . ? 7_556 ? 5 AC1 8 SER A 71 ? SER A 71 . ? 4_565 ? 6 AC1 8 HOH E . ? HOH A 101 . ? 7_556 ? 7 AC1 8 HOH E . ? HOH A 104 . ? 7_556 ? 8 AC1 8 HOH E . ? HOH A 154 . ? 4_565 ? 9 AC2 9 PRO A 23 ? PRO A 23 . ? 5_645 ? 10 AC2 9 LYS A 72 ? LYS A 72 . ? 5_645 ? 11 AC2 9 SER A 84 ? SER A 84 . ? 1_555 ? 12 AC2 9 ILE A 85 ? ILE A 85 . ? 1_555 ? 13 AC2 9 ASP A 86 ? ASP A 86 . ? 1_555 ? 14 AC2 9 ARG A 89 ? ARG A 89 . ? 1_555 ? 15 AC2 9 HOH E . ? HOH A 111 . ? 1_555 ? 16 AC2 9 HOH E . ? HOH A 152 . ? 1_555 ? 17 AC2 9 CXS D . ? CXS A 211 . ? 5_645 ? 18 AC3 8 ALA A 21 ? ALA A 21 . ? 1_555 ? 19 AC3 8 GLY A 22 ? GLY A 22 . ? 1_555 ? 20 AC3 8 PRO A 23 ? PRO A 23 . ? 1_555 ? 21 AC3 8 PRO A 78 ? PRO A 78 . ? 5_655 ? 22 AC3 8 ARG A 89 ? ARG A 89 . ? 5_655 ? 23 AC3 8 HOH E . ? HOH A 102 . ? 5_655 ? 24 AC3 8 HOH E . ? HOH A 105 . ? 1_555 ? 25 AC3 8 CXS C . ? CXS A 201 . ? 5_655 ? # _database_PDB_matrix.entry_id 1RZL _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1RZL _atom_sites.fract_transf_matrix[1][1] 0.026364 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026364 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010218 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 1 1 ILE ILE A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 CYS 73 73 73 CYS CYS A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 CYS 87 87 87 CYS CYS A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 SER 91 91 91 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 216 216 SO4 SO4 A . C 3 CXS 1 201 201 CXS CXS A . D 3 CXS 1 211 211 CXS CXS A . E 4 HOH 1 92 92 HOH HOH A . E 4 HOH 2 93 93 HOH HOH A . E 4 HOH 3 94 94 HOH HOH A . E 4 HOH 4 95 95 HOH HOH A . E 4 HOH 5 96 96 HOH HOH A . E 4 HOH 6 97 97 HOH HOH A . E 4 HOH 7 98 98 HOH HOH A . E 4 HOH 8 99 99 HOH HOH A . E 4 HOH 9 100 100 HOH HOH A . E 4 HOH 10 101 101 HOH HOH A . E 4 HOH 11 102 102 HOH HOH A . E 4 HOH 12 103 103 HOH HOH A . E 4 HOH 13 104 104 HOH HOH A . E 4 HOH 14 105 105 HOH HOH A . E 4 HOH 15 106 106 HOH HOH A . E 4 HOH 16 107 107 HOH HOH A . E 4 HOH 17 108 108 HOH HOH A . E 4 HOH 18 109 109 HOH HOH A . E 4 HOH 19 110 110 HOH HOH A . E 4 HOH 20 111 111 HOH HOH A . E 4 HOH 21 112 112 HOH HOH A . E 4 HOH 22 113 113 HOH HOH A . E 4 HOH 23 114 114 HOH HOH A . E 4 HOH 24 115 115 HOH HOH A . E 4 HOH 25 116 116 HOH HOH A . E 4 HOH 26 117 117 HOH HOH A . E 4 HOH 27 118 118 HOH HOH A . E 4 HOH 28 119 119 HOH HOH A . E 4 HOH 29 120 120 HOH HOH A . E 4 HOH 30 122 122 HOH HOH A . E 4 HOH 31 123 123 HOH HOH A . E 4 HOH 32 124 124 HOH HOH A . E 4 HOH 33 125 125 HOH HOH A . E 4 HOH 34 126 126 HOH HOH A . E 4 HOH 35 127 127 HOH HOH A . E 4 HOH 36 128 128 HOH HOH A . E 4 HOH 37 129 129 HOH HOH A . E 4 HOH 38 130 130 HOH HOH A . E 4 HOH 39 131 131 HOH HOH A . E 4 HOH 40 132 132 HOH HOH A . E 4 HOH 41 133 133 HOH HOH A . E 4 HOH 42 134 134 HOH HOH A . E 4 HOH 43 135 135 HOH HOH A . E 4 HOH 44 136 136 HOH HOH A . E 4 HOH 45 137 137 HOH HOH A . E 4 HOH 46 138 138 HOH HOH A . E 4 HOH 47 139 139 HOH HOH A . E 4 HOH 48 140 140 HOH HOH A . E 4 HOH 49 141 141 HOH HOH A . E 4 HOH 50 142 142 HOH HOH A . E 4 HOH 51 143 143 HOH HOH A . E 4 HOH 52 144 144 HOH HOH A . E 4 HOH 53 145 145 HOH HOH A . E 4 HOH 54 146 146 HOH HOH A . E 4 HOH 55 147 147 HOH HOH A . E 4 HOH 56 148 148 HOH HOH A . E 4 HOH 57 149 149 HOH HOH A . E 4 HOH 58 150 150 HOH HOH A . E 4 HOH 59 152 152 HOH HOH A . E 4 HOH 60 153 153 HOH HOH A . E 4 HOH 61 154 154 HOH HOH A . E 4 HOH 62 155 155 HOH HOH A . E 4 HOH 63 156 156 HOH HOH A . E 4 HOH 64 157 157 HOH HOH A . E 4 HOH 65 158 158 HOH HOH A . E 4 HOH 66 159 159 HOH HOH A . E 4 HOH 67 160 160 HOH HOH A . E 4 HOH 68 161 161 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2490 ? 1 MORE -22 ? 1 'SSA (A^2)' 8940 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_556 y,x,-z+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 97.8700000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-12-16 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-04-18 5 'Structure model' 1 4 2023-08-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' Other 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Derived calculations' 8 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' diffrn_detector 2 4 'Structure model' pdbx_database_status 3 5 'Structure model' database_2 4 5 'Structure model' pdbx_initial_refinement_model 5 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_diffrn_detector.detector' 2 4 'Structure model' '_pdbx_database_status.process_site' 3 5 'Structure model' '_database_2.pdbx_DOI' 4 5 'Structure model' '_database_2.pdbx_database_accession' 5 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MADNES 'data collection' . ? 1 X-PLOR 'model building' . ? 2 X-PLOR refinement . ? 3 MADNES 'data reduction' . ? 4 X-PLOR phasing . ? 5 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 '3-CYCLOHEXYL-1-PROPYLSULFONIC ACID' CXS 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1MZL _pdbx_initial_refinement_model.details ? #