data_1RZS # _entry.id 1RZS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1RZS pdb_00001rzs 10.2210/pdb1rzs/pdb RCSB RCSB021188 ? ? WWPDB D_1000021188 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1RZS _pdbx_database_status.recvd_initial_deposition_date 2003-12-28 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Newlove, T.' 1 'Konieczka, J.H.' 2 'Cordes, M.H.' 3 # _citation.id primary _citation.title 'Secondary structure switching in Cro protein evolution.' _citation.journal_abbrev STRUCTURE _citation.journal_volume 12 _citation.page_first 569 _citation.page_last 581 _citation.year 2004 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15062080 _citation.pdbx_database_id_DOI 10.1016/j.str.2004.02.024 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Newlove, T.' 1 ? primary 'Konieczka, J.H.' 2 ? primary 'Cordes, M.H.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Regulatory protein cro' _entity.formula_weight 6837.767 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Antirepressor # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MYKKDVIDHFGTQRAVAKALGISDAAVSQWKEVIPEKDAYRLEIVTAGALKYQENAYRQAA _entity_poly.pdbx_seq_one_letter_code_can MYKKDVIDHFGTQRAVAKALGISDAAVSQWKEVIPEKDAYRLEIVTAGALKYQENAYRQAA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 TYR n 1 3 LYS n 1 4 LYS n 1 5 ASP n 1 6 VAL n 1 7 ILE n 1 8 ASP n 1 9 HIS n 1 10 PHE n 1 11 GLY n 1 12 THR n 1 13 GLN n 1 14 ARG n 1 15 ALA n 1 16 VAL n 1 17 ALA n 1 18 LYS n 1 19 ALA n 1 20 LEU n 1 21 GLY n 1 22 ILE n 1 23 SER n 1 24 ASP n 1 25 ALA n 1 26 ALA n 1 27 VAL n 1 28 SER n 1 29 GLN n 1 30 TRP n 1 31 LYS n 1 32 GLU n 1 33 VAL n 1 34 ILE n 1 35 PRO n 1 36 GLU n 1 37 LYS n 1 38 ASP n 1 39 ALA n 1 40 TYR n 1 41 ARG n 1 42 LEU n 1 43 GLU n 1 44 ILE n 1 45 VAL n 1 46 THR n 1 47 ALA n 1 48 GLY n 1 49 ALA n 1 50 LEU n 1 51 LYS n 1 52 TYR n 1 53 GLN n 1 54 GLU n 1 55 ASN n 1 56 ALA n 1 57 TYR n 1 58 ARG n 1 59 GLN n 1 60 ALA n 1 61 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus 'P22-like viruses' _entity_src_gen.pdbx_gene_src_gene CRO _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage P22' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10754 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 DE3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RCRO_BPP22 _struct_ref.pdbx_db_accession P09964 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MYKKDVIDHFGTQRAVAKALGISDAAVSQWKEVIPEKDAYRLEIVTAGALKYQENAYRQAA _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1RZS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 61 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P09964 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 61 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 61 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 2 1 HNHA 3 2 1 HNHB 4 2 1 3D_15N-separated_NOESY 5 3 1 3D_13C-separated_NOESY 6 4 1 'hydrogen exchange' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 293 ambient 6.4 '50 mM sodium phosphate' ? K 2 300 ambient 6.4 '50 mM sodium phosphate' ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '6 mM P22 Cro, 50 mM sodium phosphate buffer, 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '3.5 mM P22 Cro U-15N, 50 mM sodium phosphate buffer, 90% H2O, 10% D2O' '90% H2O/10% D2O' 3 '2.75 mM P22 Cro U-15N, 13C, 50 mM sodium phosphate buffer, 90% H2O, 10% D2O' '90% H2O/10% D2O' 4 '3.5 mM P22 Cro U-15N, 50 mM sodium phosphate buffer, 100% D2O' '100% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1RZS _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;30 structures were calculated using 916 NOE-derived distance restraints, 10 hydrogen bond distance restraints, 41 phi angle restraints and 5 chi1 angle restraints. 23 of 30 calculated structures were initially accepted based on no distance restraint violations greater than 0.4 angstroms and no angle restraint violations greater than 5 degrees. Of the 23, 2 were eliminated for having significantly higher energy than the others, leaving 21 structures in the final ensemble. The ordered region of the structure includes residues 1-57. Pairwise RMSDs for the ordered region were 0.53 A (backbone atoms) and 1.29 A (all heavy atoms). None of the backbone angles in the ordered region of any ensemble member fell outside the most favorable and additionally allowed regions of a Ramachandran plot. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1RZS _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 21 _pdbx_nmr_ensemble.conformer_selection_criteria 'agreement with distance and angle restraints; two structures were also eliminated due to high energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1RZS _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 3.1 collection Bruker 1 NMRPipe ? processing 'F. Delaglio et al' 2 NMRView 4.1.3 'data analysis' 'B. Johnson' 3 CNS 1.1 'structure solution' 'A. Brunger et al' 4 CNS 1.1 refinement 'A. Brunger et al' 5 # _exptl.entry_id 1RZS _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1RZS _struct.title 'Solution structure of P22 Cro' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1RZS _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'HELIX-TURN-HELIX, DNA-BINDING PROTEIN, STRUCTURAL EVOLUTION, TRANSCRIPTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 2 ? GLY A 11 ? TYR A 2 GLY A 11 1 ? 10 HELX_P HELX_P2 2 THR A 12 ? GLY A 21 ? THR A 12 GLY A 21 1 ? 10 HELX_P HELX_P3 3 SER A 23 ? TRP A 30 ? SER A 23 TRP A 30 1 ? 8 HELX_P HELX_P4 4 PRO A 35 ? THR A 46 ? PRO A 35 THR A 46 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1RZS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1RZS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 TYR 2 2 2 TYR TYR A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ALA 61 61 61 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-06-01 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 31 ? ? -121.39 -163.64 2 1 GLU A 54 ? ? -86.06 45.12 3 1 ASN A 55 ? ? -90.34 -62.00 4 1 ALA A 60 ? ? -155.06 63.86 5 2 GLN A 59 ? ? -150.32 35.15 6 3 PRO A 35 ? ? -51.78 -175.96 7 3 ASN A 55 ? ? -53.28 -70.44 8 3 ALA A 60 ? ? -92.70 -66.86 9 4 ILE A 22 ? ? -111.73 -96.41 10 4 ALA A 60 ? ? -160.03 98.41 11 5 PRO A 35 ? ? -49.38 176.44 12 6 LYS A 31 ? ? -110.25 -163.52 13 6 PRO A 35 ? ? -48.54 168.74 14 6 ASN A 55 ? ? -46.48 -75.00 15 7 PRO A 35 ? ? -53.33 -179.90 16 7 THR A 46 ? ? -83.43 39.06 17 7 ALA A 47 ? ? 49.26 27.22 18 7 ALA A 60 ? ? 63.04 -81.14 19 8 TYR A 57 ? ? -146.45 29.59 20 9 TRP A 30 ? ? -55.17 170.98 21 9 PRO A 35 ? ? -49.27 179.56 22 9 TYR A 57 ? ? -153.07 28.74 23 10 LYS A 31 ? ? -110.54 -163.50 24 10 TYR A 57 ? ? -142.07 23.11 25 10 ALA A 60 ? ? -100.71 -70.97 26 11 LYS A 31 ? ? -127.71 -164.27 27 11 TYR A 40 ? ? -66.48 -70.29 28 11 THR A 46 ? ? -83.16 32.60 29 12 LYS A 31 ? ? -105.39 -169.81 30 12 TYR A 40 ? ? -67.37 -70.42 31 13 LYS A 31 ? ? -119.32 -163.25 32 13 THR A 46 ? ? -88.26 37.78 33 13 ALA A 47 ? ? 46.89 28.83 34 13 GLU A 54 ? ? -90.10 44.69 35 13 ASN A 55 ? ? -90.28 -74.79 36 14 PRO A 35 ? ? -49.24 158.34 37 14 GLU A 54 ? ? -90.12 37.42 38 14 ARG A 58 ? ? -98.20 45.92 39 14 ALA A 60 ? ? -145.39 33.10 40 15 TRP A 30 ? ? -53.17 -178.18 41 15 ASN A 55 ? ? -72.76 -74.96 42 15 ALA A 60 ? ? 64.89 -78.48 43 16 GLU A 54 ? ? -90.25 38.09 44 16 ASN A 55 ? ? -90.40 -76.90 45 17 ALA A 19 ? ? -132.07 -46.29 46 17 PRO A 35 ? ? -53.55 -175.05 47 17 ALA A 60 ? ? -139.16 -47.37 48 18 LYS A 31 ? ? -126.71 -166.61 49 18 PRO A 35 ? ? -51.00 171.35 50 18 GLU A 54 ? ? -89.16 46.33 51 18 ALA A 60 ? ? -169.39 119.49 52 19 TYR A 57 ? ? -140.43 22.88 53 19 GLN A 59 ? ? -117.68 74.78 54 20 PRO A 35 ? ? -49.11 166.52 55 20 TYR A 40 ? ? -67.67 -75.34 56 20 ALA A 60 ? ? 59.68 176.09 57 21 PRO A 35 ? ? -49.91 161.53 58 21 GLU A 54 ? ? -90.29 34.37 59 21 ALA A 60 ? ? 59.89 -177.82 #