data_1S04 # _entry.id 1S04 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1S04 pdb_00001s04 10.2210/pdb1s04/pdb RCSB RCSB021198 ? ? WWPDB D_1000021198 ? ? BMRB 6045 ? 10.13018/BMR6045 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-01-04 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2020-02-05 5 'Structure model' 1 4 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_related 3 4 'Structure model' pdbx_database_status 4 4 'Structure model' pdbx_nmr_software 5 4 'Structure model' pdbx_struct_assembly 6 4 'Structure model' pdbx_struct_oper_list 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_related.db_name' 2 4 'Structure model' '_pdbx_database_status.status_code_cs' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 5 'Structure model' '_database_2.pdbx_DOI' 5 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1S04 _pdbx_database_status.recvd_initial_deposition_date 2003-12-29 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type BMRB 6045 'Chemical Shifts and Structural Constraints' unspecified TargetDB PfR13 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'liu, G.' 1 'Xiao, R.' 2 'Sukumaran, D.K.' 3 'Acton, T.' 4 'Montelione, G.T.' 5 'Szyperski, T.' 6 'Northeast Structural Genomics Consortium (NESG)' 7 # _citation.id primary _citation.title ;Solution Structure Of The Hypothetical Protein PF0455 From Pyrococcus furiosus: Northeast Structural Genomics Consortium Target PfR13 ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'liu, G.' 1 ? primary 'Xiao, R.' 2 ? primary 'Sukumaran, D.K.' 3 ? primary 'Acton, T.' 4 ? primary 'Montelione, G.T.' 5 ? primary 'Szyperski, T.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'hypothetical protein PF0455' _entity.formula_weight 13179.319 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEWEMGLQEEFLELIKLRKKKIEGRLYDEKRRQIKPGDVISFEGGKLKVRVKAIRVYNSFREMLEKEGLENVLPGVKSIE EGIQVYRRFYDEEKEKKYGVVAIEIEPLEY ; _entity_poly.pdbx_seq_one_letter_code_can ;MEWEMGLQEEFLELIKLRKKKIEGRLYDEKRRQIKPGDVISFEGGKLKVRVKAIRVYNSFREMLEKEGLENVLPGVKSIE EGIQVYRRFYDEEKEKKYGVVAIEIEPLEY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier PfR13 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 TRP n 1 4 GLU n 1 5 MET n 1 6 GLY n 1 7 LEU n 1 8 GLN n 1 9 GLU n 1 10 GLU n 1 11 PHE n 1 12 LEU n 1 13 GLU n 1 14 LEU n 1 15 ILE n 1 16 LYS n 1 17 LEU n 1 18 ARG n 1 19 LYS n 1 20 LYS n 1 21 LYS n 1 22 ILE n 1 23 GLU n 1 24 GLY n 1 25 ARG n 1 26 LEU n 1 27 TYR n 1 28 ASP n 1 29 GLU n 1 30 LYS n 1 31 ARG n 1 32 ARG n 1 33 GLN n 1 34 ILE n 1 35 LYS n 1 36 PRO n 1 37 GLY n 1 38 ASP n 1 39 VAL n 1 40 ILE n 1 41 SER n 1 42 PHE n 1 43 GLU n 1 44 GLY n 1 45 GLY n 1 46 LYS n 1 47 LEU n 1 48 LYS n 1 49 VAL n 1 50 ARG n 1 51 VAL n 1 52 LYS n 1 53 ALA n 1 54 ILE n 1 55 ARG n 1 56 VAL n 1 57 TYR n 1 58 ASN n 1 59 SER n 1 60 PHE n 1 61 ARG n 1 62 GLU n 1 63 MET n 1 64 LEU n 1 65 GLU n 1 66 LYS n 1 67 GLU n 1 68 GLY n 1 69 LEU n 1 70 GLU n 1 71 ASN n 1 72 VAL n 1 73 LEU n 1 74 PRO n 1 75 GLY n 1 76 VAL n 1 77 LYS n 1 78 SER n 1 79 ILE n 1 80 GLU n 1 81 GLU n 1 82 GLY n 1 83 ILE n 1 84 GLN n 1 85 VAL n 1 86 TYR n 1 87 ARG n 1 88 ARG n 1 89 PHE n 1 90 TYR n 1 91 ASP n 1 92 GLU n 1 93 GLU n 1 94 LYS n 1 95 GLU n 1 96 LYS n 1 97 LYS n 1 98 TYR n 1 99 GLY n 1 100 VAL n 1 101 VAL n 1 102 ALA n 1 103 ILE n 1 104 GLU n 1 105 ILE n 1 106 GLU n 1 107 PRO n 1 108 LEU n 1 109 GLU n 1 110 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pyrococcus _entity_src_gen.pdbx_gene_src_gene PF0455 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus furiosus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2261 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pPfR13-21.2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 TRP 3 3 3 TRP TRP A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 MET 63 63 63 MET MET A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 TYR 110 110 110 TYR TYR A . n # _cell.entry_id 1S04 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1S04 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1S04 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1S04 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1S04 _struct.title 'Solution NMR Structure of Protein PF0455 from Pyrococcus furiosus. Northeast Structural Genomics Consortium Target PfR13' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1S04 _struct_keywords.pdbx_keywords 'Structural genomics, unknown function' _struct_keywords.text ;Structural genomics, PfR13, PF0455, Reduced-dimensionality, GFT, Northeast Structural Genomics Consortium, NESG, protein structure initiative, PSI, unknown function ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8U3L1_PYRFU _struct_ref.pdbx_db_accession Q8U3L1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEWEMGLQEEFLELIKLRKKKIEGRLYDEKRRQIKPGDVISFEGGKLKVRVKAIRVYNSFREMLEKEGLENVLPGVKSIE EGIQVYRRFYDEEKEKKYGVVAIEIEPLEY ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1S04 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 110 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8U3L1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 110 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 110 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 8 ? ARG A 18 ? GLN A 8 ARG A 18 1 ? 11 HELX_P HELX_P2 2 ASP A 28 ? ILE A 34 ? ASP A 28 ILE A 34 1 ? 7 HELX_P HELX_P3 3 SER A 59 ? GLU A 67 ? SER A 59 GLU A 67 1 ? 9 HELX_P HELX_P4 4 SER A 78 ? TYR A 90 ? SER A 78 TYR A 90 1 ? 13 HELX_P HELX_P5 5 ASP A 91 ? TYR A 98 ? ASP A 91 TYR A 98 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 3 ? MET A 5 ? TRP A 3 MET A 5 A 2 ILE A 40 ? PHE A 42 ? ILE A 40 PHE A 42 A 3 LEU A 47 ? ALA A 53 ? LEU A 47 ALA A 53 A 4 GLU A 104 ? GLU A 106 ? GLU A 104 GLU A 106 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TRP A 3 ? N TRP A 3 O SER A 41 ? O SER A 41 A 2 3 N ILE A 40 ? N ILE A 40 O VAL A 49 ? O VAL A 49 A 3 4 N ALA A 53 ? N ALA A 53 O GLU A 104 ? O GLU A 104 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A ILE 40 ? ? O A VAL 49 ? ? 1.55 2 1 O A PHE 60 ? ? H A LEU 64 ? ? 1.57 3 2 O A TRP 3 ? ? H A SER 41 ? ? 1.55 4 2 O A LEU 69 ? ? H A LEU 73 ? ? 1.58 5 3 O A LEU 69 ? ? H A LEU 73 ? ? 1.47 6 4 HZ1 A LYS 16 ? ? OE1 A GLU 109 ? ? 1.58 7 4 O A TYR 86 ? ? H A TYR 90 ? ? 1.59 8 5 O A GLU 67 ? ? HD21 A ASN 71 ? ? 1.52 9 5 O A GLU 92 ? ? H A LYS 96 ? ? 1.60 10 6 H A LYS 52 ? ? O A GLU 104 ? ? 1.52 11 6 O A GLU 62 ? ? H A LYS 66 ? ? 1.59 12 7 HH A TYR 57 ? ? OE2 A GLU 67 ? ? 1.51 13 7 O A ARG 61 ? ? H A GLU 65 ? ? 1.54 14 8 O A LEU 14 ? ? H A ARG 18 ? ? 1.47 15 8 O A LEU 69 ? ? H A LEU 73 ? ? 1.52 16 10 O A LEU 14 ? ? H A ARG 18 ? ? 1.47 17 10 O A TRP 3 ? ? H A SER 41 ? ? 1.51 18 10 HG A SER 41 ? ? O A GLY 44 ? ? 1.57 19 12 O A TRP 3 ? ? H A SER 41 ? ? 1.50 20 12 O A LEU 69 ? ? H A LEU 73 ? ? 1.54 21 12 H A LYS 52 ? ? O A GLU 104 ? ? 1.55 22 13 O A TRP 3 ? ? H A SER 41 ? ? 1.52 23 13 O A LEU 69 ? ? H A LEU 73 ? ? 1.58 24 14 O A LEU 69 ? ? H A LEU 73 ? ? 1.55 25 14 O A GLU 92 ? ? H A LYS 96 ? ? 1.56 26 15 O A LEU 14 ? ? H A ARG 18 ? ? 1.52 27 15 H A ILE 40 ? ? O A VAL 49 ? ? 1.53 28 15 O A LEU 69 ? ? H A LEU 73 ? ? 1.54 29 16 O A LEU 14 ? ? H A ARG 18 ? ? 1.47 30 16 H A MET 5 ? ? O A SER 41 ? ? 1.50 31 16 O A LEU 69 ? ? H A LEU 73 ? ? 1.55 32 16 O A TRP 3 ? ? H A SER 41 ? ? 1.60 33 17 O A LEU 14 ? ? H A ARG 18 ? ? 1.45 34 17 H A MET 5 ? ? O A SER 41 ? ? 1.51 35 18 O A LEU 69 ? ? H A LEU 73 ? ? 1.52 36 18 H A ILE 40 ? ? O A VAL 49 ? ? 1.55 37 19 O A LEU 14 ? ? H A ARG 18 ? ? 1.47 38 19 H A ILE 40 ? ? O A VAL 49 ? ? 1.54 39 19 O A PHE 60 ? ? H A LEU 64 ? ? 1.60 40 20 O A TRP 3 ? ? H A SER 41 ? ? 1.50 41 20 O A LEU 69 ? ? H A LEU 73 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 21 ? ? -125.70 -114.12 2 1 ARG A 25 ? ? 158.46 104.59 3 1 LEU A 26 ? ? -39.30 133.66 4 1 ASP A 38 ? ? -164.88 -166.45 5 1 VAL A 72 ? ? -133.99 -52.44 6 1 VAL A 76 ? ? -39.43 148.73 7 1 LEU A 108 ? ? -100.74 51.06 8 2 LYS A 21 ? ? -123.04 -113.53 9 2 ARG A 25 ? ? 171.64 114.50 10 2 LEU A 26 ? ? -39.41 135.40 11 2 TYR A 27 ? ? -69.24 89.98 12 2 VAL A 72 ? ? -139.60 -48.05 13 2 VAL A 76 ? ? -39.97 148.60 14 2 GLU A 109 ? ? -126.24 -98.21 15 3 LYS A 21 ? ? -124.54 -111.37 16 3 ARG A 25 ? ? 161.01 129.24 17 3 LEU A 26 ? ? -37.43 124.81 18 3 ASP A 28 ? ? -178.52 -176.00 19 3 ASP A 38 ? ? -164.33 -169.56 20 3 VAL A 76 ? ? -39.82 152.05 21 4 LYS A 21 ? ? -119.43 -115.27 22 4 LEU A 26 ? ? -55.65 109.73 23 4 TYR A 27 ? ? -45.75 173.37 24 4 VAL A 72 ? ? -138.37 -53.98 25 4 VAL A 76 ? ? -38.47 155.72 26 5 MET A 5 ? ? -124.10 -159.26 27 5 LYS A 21 ? ? -115.69 -116.24 28 5 ARG A 25 ? ? 175.74 -178.36 29 5 ASP A 28 ? ? -68.96 -176.57 30 5 VAL A 72 ? ? -152.46 -56.49 31 5 VAL A 76 ? ? -39.82 150.70 32 5 GLU A 109 ? ? -130.14 -101.03 33 6 LYS A 21 ? ? -118.77 -114.68 34 6 ARG A 25 ? ? 158.91 121.43 35 6 LEU A 26 ? ? -39.04 133.00 36 6 ASP A 28 ? ? -101.19 -168.10 37 6 GLU A 43 ? ? 39.14 40.19 38 6 VAL A 72 ? ? -137.30 -58.20 39 6 GLU A 109 ? ? -146.67 -104.85 40 7 LYS A 21 ? ? -126.15 -115.23 41 7 ARG A 25 ? ? 175.88 101.14 42 7 LEU A 26 ? ? -38.56 141.41 43 7 VAL A 72 ? ? -137.33 -58.78 44 7 VAL A 76 ? ? -38.81 146.72 45 7 GLU A 109 ? ? -69.40 -96.60 46 8 LYS A 21 ? ? -126.23 -103.23 47 8 ARG A 25 ? ? 170.27 110.09 48 8 LEU A 26 ? ? -38.78 135.84 49 8 VAL A 72 ? ? -134.93 -46.44 50 8 VAL A 76 ? ? -39.51 152.95 51 9 MET A 5 ? ? -174.08 105.38 52 9 LYS A 21 ? ? -113.70 -111.78 53 9 ARG A 25 ? ? 158.48 135.88 54 9 ASP A 28 ? ? -70.46 -166.87 55 9 ASP A 38 ? ? -67.45 -171.65 56 9 VAL A 72 ? ? -136.18 -54.00 57 9 VAL A 76 ? ? -39.50 153.13 58 9 GLU A 109 ? ? -146.27 -142.98 59 10 LEU A 7 ? ? -171.39 146.76 60 10 LYS A 21 ? ? -128.85 -107.66 61 10 ARG A 25 ? ? 161.24 100.99 62 10 LEU A 26 ? ? -36.46 123.01 63 10 GLU A 43 ? ? 38.04 40.30 64 10 VAL A 72 ? ? -137.94 -49.62 65 10 VAL A 76 ? ? -38.56 148.17 66 10 LEU A 108 ? ? -59.00 87.30 67 10 GLU A 109 ? ? -160.85 -145.97 68 11 LYS A 21 ? ? -117.33 -112.19 69 11 ILE A 22 ? ? -167.21 -167.12 70 11 ARG A 25 ? ? 177.59 105.96 71 11 LEU A 26 ? ? -39.12 153.06 72 11 VAL A 72 ? ? -137.42 -50.19 73 11 VAL A 76 ? ? -39.33 152.11 74 11 GLU A 109 ? ? -121.60 -143.27 75 12 LYS A 21 ? ? -115.05 -114.76 76 12 ARG A 25 ? ? 177.08 145.89 77 12 TYR A 27 ? ? -63.77 90.66 78 12 VAL A 72 ? ? -139.76 -46.39 79 12 VAL A 76 ? ? -39.79 149.25 80 12 GLU A 106 ? ? -162.18 100.21 81 12 GLU A 109 ? ? -133.58 -141.75 82 13 LYS A 21 ? ? -125.42 -116.84 83 13 ILE A 22 ? ? -145.67 -149.97 84 13 ARG A 25 ? ? 160.27 115.14 85 13 VAL A 72 ? ? -137.20 -51.15 86 13 VAL A 76 ? ? -40.04 151.36 87 14 LYS A 21 ? ? -120.46 -115.49 88 14 ARG A 25 ? ? 176.09 120.88 89 14 LEU A 26 ? ? -37.86 127.11 90 14 ASP A 28 ? ? -104.36 -160.97 91 14 VAL A 72 ? ? -140.27 -47.02 92 14 VAL A 76 ? ? -39.07 149.58 93 15 LEU A 7 ? ? -75.72 -113.75 94 15 LYS A 21 ? ? -131.23 -105.57 95 15 ARG A 25 ? ? 179.26 99.64 96 15 LEU A 26 ? ? -37.22 143.76 97 15 ASP A 28 ? ? -68.03 -179.23 98 15 VAL A 72 ? ? -134.93 -46.83 99 15 VAL A 76 ? ? -39.92 149.71 100 15 LEU A 108 ? ? -101.51 58.39 101 15 GLU A 109 ? ? -117.69 -142.73 102 16 LYS A 21 ? ? -132.44 -104.03 103 16 ARG A 25 ? ? 179.38 108.87 104 16 LEU A 26 ? ? -36.94 132.60 105 16 VAL A 72 ? ? -136.19 -52.61 106 16 VAL A 76 ? ? -38.60 152.92 107 16 GLU A 106 ? ? -160.78 102.62 108 16 LEU A 108 ? ? -100.58 54.37 109 17 LYS A 21 ? ? -129.76 -101.65 110 17 ARG A 25 ? ? 159.43 117.96 111 17 LEU A 26 ? ? -39.19 135.92 112 17 ASP A 28 ? ? -102.52 -169.74 113 17 VAL A 72 ? ? -146.80 -55.29 114 17 VAL A 76 ? ? -38.93 150.36 115 18 LEU A 7 ? ? -170.48 -179.12 116 18 LYS A 21 ? ? -116.67 -113.55 117 18 ARG A 25 ? ? 176.74 137.67 118 18 LEU A 26 ? ? -37.46 111.23 119 18 VAL A 72 ? ? -137.51 -51.77 120 18 VAL A 76 ? ? -43.39 157.31 121 18 TYR A 90 ? ? -116.26 -161.70 122 18 GLU A 109 ? ? -149.52 20.23 123 19 LYS A 21 ? ? -126.78 -107.12 124 19 ARG A 25 ? ? 178.88 115.96 125 19 LEU A 26 ? ? -37.23 133.63 126 19 TYR A 27 ? ? -65.74 77.07 127 19 ASP A 28 ? ? -71.25 -165.66 128 19 VAL A 72 ? ? -138.07 -50.50 129 19 VAL A 76 ? ? -38.37 148.83 130 19 GLU A 109 ? ? -143.06 16.87 131 20 LYS A 21 ? ? -116.67 -116.00 132 20 ARG A 25 ? ? 169.67 117.65 133 20 LEU A 26 ? ? -39.87 144.86 134 20 VAL A 72 ? ? -137.66 -49.42 135 20 VAL A 76 ? ? -38.30 152.18 136 20 LEU A 108 ? ? -61.44 88.50 137 20 GLU A 109 ? ? -162.24 -141.89 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_nmr_ensemble.entry_id 1S04 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1S04 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20 mM MES, 100 mM NaCl, 10 mM DTT, 5 mM CaCl2, 0.02% NaN3, 95% H2O/5% D2O, protein U-15N,13C' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY 3 1 1 HNHA 4 1 1 '3D RD HCCHCOSY' 5 1 1 'GFT (4,3)D HNNCACBCA' 6 1 1 'GFT (4,3)D HNN(CO)CACBCA' # _pdbx_nmr_refine.entry_id 1S04 _pdbx_nmr_refine.method 'distance geometry, simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DYANA 1.5 refinement Guntert 1 XEASY 1.3 'data analysis' Bartels 2 NMRPipe 1.0 processing Delaglio 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 MET N N N N 192 MET CA C N S 193 MET C C N N 194 MET O O N N 195 MET CB C N N 196 MET CG C N N 197 MET SD S N N 198 MET CE C N N 199 MET OXT O N N 200 MET H H N N 201 MET H2 H N N 202 MET HA H N N 203 MET HB2 H N N 204 MET HB3 H N N 205 MET HG2 H N N 206 MET HG3 H N N 207 MET HE1 H N N 208 MET HE2 H N N 209 MET HE3 H N N 210 MET HXT H N N 211 PHE N N N N 212 PHE CA C N S 213 PHE C C N N 214 PHE O O N N 215 PHE CB C N N 216 PHE CG C Y N 217 PHE CD1 C Y N 218 PHE CD2 C Y N 219 PHE CE1 C Y N 220 PHE CE2 C Y N 221 PHE CZ C Y N 222 PHE OXT O N N 223 PHE H H N N 224 PHE H2 H N N 225 PHE HA H N N 226 PHE HB2 H N N 227 PHE HB3 H N N 228 PHE HD1 H N N 229 PHE HD2 H N N 230 PHE HE1 H N N 231 PHE HE2 H N N 232 PHE HZ H N N 233 PHE HXT H N N 234 PRO N N N N 235 PRO CA C N S 236 PRO C C N N 237 PRO O O N N 238 PRO CB C N N 239 PRO CG C N N 240 PRO CD C N N 241 PRO OXT O N N 242 PRO H H N N 243 PRO HA H N N 244 PRO HB2 H N N 245 PRO HB3 H N N 246 PRO HG2 H N N 247 PRO HG3 H N N 248 PRO HD2 H N N 249 PRO HD3 H N N 250 PRO HXT H N N 251 SER N N N N 252 SER CA C N S 253 SER C C N N 254 SER O O N N 255 SER CB C N N 256 SER OG O N N 257 SER OXT O N N 258 SER H H N N 259 SER H2 H N N 260 SER HA H N N 261 SER HB2 H N N 262 SER HB3 H N N 263 SER HG H N N 264 SER HXT H N N 265 TRP N N N N 266 TRP CA C N S 267 TRP C C N N 268 TRP O O N N 269 TRP CB C N N 270 TRP CG C Y N 271 TRP CD1 C Y N 272 TRP CD2 C Y N 273 TRP NE1 N Y N 274 TRP CE2 C Y N 275 TRP CE3 C Y N 276 TRP CZ2 C Y N 277 TRP CZ3 C Y N 278 TRP CH2 C Y N 279 TRP OXT O N N 280 TRP H H N N 281 TRP H2 H N N 282 TRP HA H N N 283 TRP HB2 H N N 284 TRP HB3 H N N 285 TRP HD1 H N N 286 TRP HE1 H N N 287 TRP HE3 H N N 288 TRP HZ2 H N N 289 TRP HZ3 H N N 290 TRP HH2 H N N 291 TRP HXT H N N 292 TYR N N N N 293 TYR CA C N S 294 TYR C C N N 295 TYR O O N N 296 TYR CB C N N 297 TYR CG C Y N 298 TYR CD1 C Y N 299 TYR CD2 C Y N 300 TYR CE1 C Y N 301 TYR CE2 C Y N 302 TYR CZ C Y N 303 TYR OH O N N 304 TYR OXT O N N 305 TYR H H N N 306 TYR H2 H N N 307 TYR HA H N N 308 TYR HB2 H N N 309 TYR HB3 H N N 310 TYR HD1 H N N 311 TYR HD2 H N N 312 TYR HE1 H N N 313 TYR HE2 H N N 314 TYR HH H N N 315 TYR HXT H N N 316 VAL N N N N 317 VAL CA C N S 318 VAL C C N N 319 VAL O O N N 320 VAL CB C N N 321 VAL CG1 C N N 322 VAL CG2 C N N 323 VAL OXT O N N 324 VAL H H N N 325 VAL H2 H N N 326 VAL HA H N N 327 VAL HB H N N 328 VAL HG11 H N N 329 VAL HG12 H N N 330 VAL HG13 H N N 331 VAL HG21 H N N 332 VAL HG22 H N N 333 VAL HG23 H N N 334 VAL HXT H N N 335 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 PRO N CA sing N N 224 PRO N CD sing N N 225 PRO N H sing N N 226 PRO CA C sing N N 227 PRO CA CB sing N N 228 PRO CA HA sing N N 229 PRO C O doub N N 230 PRO C OXT sing N N 231 PRO CB CG sing N N 232 PRO CB HB2 sing N N 233 PRO CB HB3 sing N N 234 PRO CG CD sing N N 235 PRO CG HG2 sing N N 236 PRO CG HG3 sing N N 237 PRO CD HD2 sing N N 238 PRO CD HD3 sing N N 239 PRO OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 TRP N CA sing N N 254 TRP N H sing N N 255 TRP N H2 sing N N 256 TRP CA C sing N N 257 TRP CA CB sing N N 258 TRP CA HA sing N N 259 TRP C O doub N N 260 TRP C OXT sing N N 261 TRP CB CG sing N N 262 TRP CB HB2 sing N N 263 TRP CB HB3 sing N N 264 TRP CG CD1 doub Y N 265 TRP CG CD2 sing Y N 266 TRP CD1 NE1 sing Y N 267 TRP CD1 HD1 sing N N 268 TRP CD2 CE2 doub Y N 269 TRP CD2 CE3 sing Y N 270 TRP NE1 CE2 sing Y N 271 TRP NE1 HE1 sing N N 272 TRP CE2 CZ2 sing Y N 273 TRP CE3 CZ3 doub Y N 274 TRP CE3 HE3 sing N N 275 TRP CZ2 CH2 doub Y N 276 TRP CZ2 HZ2 sing N N 277 TRP CZ3 CH2 sing Y N 278 TRP CZ3 HZ3 sing N N 279 TRP CH2 HH2 sing N N 280 TRP OXT HXT sing N N 281 TYR N CA sing N N 282 TYR N H sing N N 283 TYR N H2 sing N N 284 TYR CA C sing N N 285 TYR CA CB sing N N 286 TYR CA HA sing N N 287 TYR C O doub N N 288 TYR C OXT sing N N 289 TYR CB CG sing N N 290 TYR CB HB2 sing N N 291 TYR CB HB3 sing N N 292 TYR CG CD1 doub Y N 293 TYR CG CD2 sing Y N 294 TYR CD1 CE1 sing Y N 295 TYR CD1 HD1 sing N N 296 TYR CD2 CE2 doub Y N 297 TYR CD2 HD2 sing N N 298 TYR CE1 CZ doub Y N 299 TYR CE1 HE1 sing N N 300 TYR CE2 CZ sing Y N 301 TYR CE2 HE2 sing N N 302 TYR CZ OH sing N N 303 TYR OH HH sing N N 304 TYR OXT HXT sing N N 305 VAL N CA sing N N 306 VAL N H sing N N 307 VAL N H2 sing N N 308 VAL CA C sing N N 309 VAL CA CB sing N N 310 VAL CA HA sing N N 311 VAL C O doub N N 312 VAL C OXT sing N N 313 VAL CB CG1 sing N N 314 VAL CB CG2 sing N N 315 VAL CB HB sing N N 316 VAL CG1 HG11 sing N N 317 VAL CG1 HG12 sing N N 318 VAL CG1 HG13 sing N N 319 VAL CG2 HG21 sing N N 320 VAL CG2 HG22 sing N N 321 VAL CG2 HG23 sing N N 322 VAL OXT HXT sing N N 323 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 750 2 ? Varian INOVA 600 # _atom_sites.entry_id 1S04 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_