data_1S4X # _entry.id 1S4X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1S4X pdb_00001s4x 10.2210/pdb1s4x/pdb RCSB RCSB021371 ? ? WWPDB D_1000021371 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1S4W _pdbx_database_related.details 'NMR structure of the integrin AIIb cytoplasmic domain in DPC micelles' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1S4X _pdbx_database_status.recvd_initial_deposition_date 2004-01-19 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Vinogradova, O.' 1 'Vaynberg, J.' 2 'Kong, X.' 3 'Haas, T.A.' 4 'Plow, E.F.' 5 'Qin, J.' 6 # _citation.id primary _citation.title 'Membrane-mediated structural transitions at the cytoplasmic face during integrin activation.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 101 _citation.page_first 4094 _citation.page_last 4099 _citation.year 2004 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15024114 _citation.pdbx_database_id_DOI 10.1073/pnas.0400742101 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Vinogradova, O.' 1 ? primary 'Vaynberg, J.' 2 ? primary 'Kong, X.' 3 ? primary 'Haas, T.A.' 4 ? primary 'Plow, E.F.' 5 ? primary 'Qin, J.' 6 ? # _cell.entry_id 1S4X _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1S4X _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Integrin beta-3' _entity.formula_weight 7757.640 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'cytoplasmic domain (residues 742-788)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Platelet membrane glycoprotein IIIa, GPIIIa, CD61 antigen' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSHHHHHHSSGLVPRGSHMKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT _entity_poly.pdbx_seq_one_letter_code_can GSSHHHHHHSSGLVPRGSHMKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 SER n 1 11 SER n 1 12 GLY n 1 13 LEU n 1 14 VAL n 1 15 PRO n 1 16 ARG n 1 17 GLY n 1 18 SER n 1 19 HIS n 1 20 MET n 1 21 LYS n 1 22 LEU n 1 23 LEU n 1 24 ILE n 1 25 THR n 1 26 ILE n 1 27 HIS n 1 28 ASP n 1 29 ARG n 1 30 LYS n 1 31 GLU n 1 32 PHE n 1 33 ALA n 1 34 LYS n 1 35 PHE n 1 36 GLU n 1 37 GLU n 1 38 GLU n 1 39 ARG n 1 40 ALA n 1 41 ARG n 1 42 ALA n 1 43 LYS n 1 44 TRP n 1 45 ASP n 1 46 THR n 1 47 ALA n 1 48 ASN n 1 49 ASN n 1 50 PRO n 1 51 LEU n 1 52 TYR n 1 53 LYS n 1 54 GLU n 1 55 ALA n 1 56 THR n 1 57 SER n 1 58 THR n 1 59 PHE n 1 60 THR n 1 61 ASN n 1 62 ILE n 1 63 THR n 1 64 TYR n 1 65 ARG n 1 66 GLY n 1 67 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'ITGB3, GP3A' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ITB3_HUMAN _struct_ref.pdbx_db_accession P05106 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT _struct_ref.pdbx_align_begin 742 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1S4X _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 67 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P05106 _struct_ref_seq.db_align_beg 742 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 788 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 21 _struct_ref_seq.pdbx_auth_seq_align_end 67 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1S4X GLY A 1 ? UNP P05106 ? ? 'cloning artifact' 1 1 1 1S4X SER A 2 ? UNP P05106 ? ? 'cloning artifact' 2 2 1 1S4X SER A 3 ? UNP P05106 ? ? 'cloning artifact' 3 3 1 1S4X HIS A 4 ? UNP P05106 ? ? 'cloning artifact' 4 4 1 1S4X HIS A 5 ? UNP P05106 ? ? 'cloning artifact' 5 5 1 1S4X HIS A 6 ? UNP P05106 ? ? 'cloning artifact' 6 6 1 1S4X HIS A 7 ? UNP P05106 ? ? 'cloning artifact' 7 7 1 1S4X HIS A 8 ? UNP P05106 ? ? 'cloning artifact' 8 8 1 1S4X HIS A 9 ? UNP P05106 ? ? 'cloning artifact' 9 9 1 1S4X SER A 10 ? UNP P05106 ? ? 'cloning artifact' 10 10 1 1S4X SER A 11 ? UNP P05106 ? ? 'cloning artifact' 11 11 1 1S4X GLY A 12 ? UNP P05106 ? ? 'cloning artifact' 12 12 1 1S4X LEU A 13 ? UNP P05106 ? ? 'cloning artifact' 13 13 1 1S4X VAL A 14 ? UNP P05106 ? ? 'cloning artifact' 14 14 1 1S4X PRO A 15 ? UNP P05106 ? ? 'cloning artifact' 15 15 1 1S4X ARG A 16 ? UNP P05106 ? ? 'cloning artifact' 16 16 1 1S4X GLY A 17 ? UNP P05106 ? ? 'cloning artifact' 17 17 1 1S4X SER A 18 ? UNP P05106 ? ? 'cloning artifact' 18 18 1 1S4X HIS A 19 ? UNP P05106 ? ? 'cloning artifact' 19 19 1 1S4X MET A 20 ? UNP P05106 ? ? 'cloning artifact' 20 20 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type '15N/13C-simulteneous separeted 3D NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.3 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM peptide, 300mM dDPC, 95/5% H2O/D2O' _pdbx_nmr_sample_details.solvent_system '95/5% H2O/D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1S4X _pdbx_nmr_refine.method 'hybrid distance geometry - dynamic simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1S4X _pdbx_nmr_ensemble.conformers_calculated_total_number 88 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1S4X _pdbx_nmr_representative.conformer_id 6 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR ? collection ? 1 NMRPipe ? processing ? 2 PIPP ? 'data analysis' ? 3 X-PLOR ? 'structure solution' ? 4 X-PLOR ? refinement ? 5 # _exptl.entry_id 1S4X _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1S4X _struct.title 'NMR Structure of the integrin B3 cytoplasmic domain in DPC micelles' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1S4X _struct_keywords.pdbx_keywords 'CELL ADHESION' _struct_keywords.text 'CELL ADHESION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 21 ? ALA A 40 ? LYS A 21 ALA A 40 1 ? 20 HELX_P HELX_P2 2 PRO A 50 ? ASN A 61 ? PRO A 50 ASN A 61 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1S4X _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1S4X _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 HIS 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 HIS 8 8 ? ? ? A . n A 1 9 HIS 9 9 ? ? ? A . n A 1 10 SER 10 10 ? ? ? A . n A 1 11 SER 11 11 ? ? ? A . n A 1 12 GLY 12 12 ? ? ? A . n A 1 13 LEU 13 13 ? ? ? A . n A 1 14 VAL 14 14 ? ? ? A . n A 1 15 PRO 15 15 ? ? ? A . n A 1 16 ARG 16 16 ? ? ? A . n A 1 17 GLY 17 17 ? ? ? A . n A 1 18 SER 18 18 ? ? ? A . n A 1 19 HIS 19 19 ? ? ? A . n A 1 20 MET 20 20 ? ? ? A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 TRP 44 44 44 TRP TRP A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 THR 67 67 67 THR THR A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-03-09 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ARG 39 ? ? H A ARG 41 ? ? 0.90 2 1 O A ARG 29 ? ? H A ALA 33 ? ? 1.42 3 1 O A SER 57 ? ? H A ASN 61 ? ? 1.49 4 1 O A LEU 23 ? ? H A HIS 27 ? ? 1.50 5 1 O A THR 60 ? ? H A TYR 64 ? ? 1.53 6 1 O A GLU 31 ? ? H A PHE 35 ? ? 1.53 7 1 O A GLU 36 ? ? H A ALA 40 ? ? 1.54 8 1 O A ARG 39 ? ? N A ARG 41 ? ? 1.83 9 2 O A ARG 39 ? ? H A ARG 41 ? ? 0.88 10 2 O A ARG 29 ? ? H A ALA 33 ? ? 1.43 11 2 O A SER 57 ? ? H A ASN 61 ? ? 1.44 12 2 O A THR 60 ? ? H A TYR 64 ? ? 1.49 13 2 O A THR 25 ? ? H A ARG 29 ? ? 1.50 14 2 O A LEU 51 ? ? H A ALA 55 ? ? 1.57 15 2 O A ARG 39 ? ? N A ARG 41 ? ? 1.81 16 3 O A ARG 39 ? ? H A ARG 41 ? ? 0.97 17 3 HD21 A ASN 48 ? ? H A ASN 49 ? ? 1.16 18 3 O A ARG 29 ? ? H A ALA 33 ? ? 1.45 19 3 O A THR 60 ? ? H A TYR 64 ? ? 1.54 20 3 O A LEU 23 ? ? H A HIS 27 ? ? 1.57 21 3 O A LEU 51 ? ? H A ALA 55 ? ? 1.60 22 3 O A ARG 39 ? ? N A ARG 41 ? ? 1.87 23 4 O A ARG 39 ? ? H A ALA 42 ? ? 1.37 24 4 O A THR 60 ? ? H A TYR 64 ? ? 1.49 25 4 O A LYS 21 ? ? HG1 A THR 25 ? ? 1.52 26 4 O A LEU 51 ? ? H A ALA 55 ? ? 1.52 27 4 O A PRO 50 ? ? H A GLU 54 ? ? 1.54 28 4 O A ARG 29 ? ? H A ALA 33 ? ? 1.59 29 4 O A ARG 39 ? ? N A ARG 41 ? ? 2.19 30 5 O A ARG 39 ? ? H A ARG 41 ? ? 0.90 31 5 O A ARG 29 ? ? H A ALA 33 ? ? 1.57 32 5 O A THR 60 ? ? H A TYR 64 ? ? 1.57 33 5 O A LEU 51 ? ? H A ALA 55 ? ? 1.59 34 5 O A ARG 39 ? ? N A ARG 41 ? ? 1.83 35 6 O A ARG 39 ? ? H A ARG 41 ? ? 0.94 36 6 HD21 A ASN 49 ? ? H A LEU 51 ? ? 1.00 37 6 O A THR 25 ? ? H A ARG 29 ? ? 1.44 38 6 O A THR 60 ? ? H A TYR 64 ? ? 1.51 39 6 O A SER 57 ? ? H A ASN 61 ? ? 1.51 40 6 OD1 A ASN 48 ? ? H A ASN 49 ? ? 1.51 41 6 O A GLU 36 ? ? H A ALA 40 ? ? 1.53 42 6 O A ARG 29 ? ? H A ALA 33 ? ? 1.59 43 6 O A LEU 51 ? ? H A ALA 55 ? ? 1.60 44 6 O A ARG 39 ? ? N A ARG 41 ? ? 1.86 45 7 O A ARG 39 ? ? H A ARG 41 ? ? 0.87 46 7 O A SER 57 ? ? H A ASN 61 ? ? 1.47 47 7 O A THR 60 ? ? H A TYR 64 ? ? 1.49 48 7 O A ARG 29 ? ? H A ALA 33 ? ? 1.56 49 7 O A THR 25 ? ? H A ARG 29 ? ? 1.57 50 7 O A LEU 51 ? ? H A ALA 55 ? ? 1.58 51 7 O A ARG 39 ? ? N A ARG 41 ? ? 1.81 52 8 O A ARG 39 ? ? H A ALA 42 ? ? 1.36 53 8 O A ARG 29 ? ? H A ALA 33 ? ? 1.43 54 8 O A PRO 50 ? ? H A GLU 54 ? ? 1.43 55 8 O A GLU 38 ? ? HE A ARG 41 ? ? 1.48 56 8 O A LEU 51 ? ? H A ALA 55 ? ? 1.54 57 8 O A LYS 21 ? ? HG1 A THR 25 ? ? 1.55 58 9 O A ARG 39 ? ? H A ARG 41 ? ? 0.90 59 9 O A SER 57 ? ? H A ASN 61 ? ? 1.53 60 9 O A THR 60 ? ? H A TYR 64 ? ? 1.54 61 9 O A GLU 36 ? ? H A ALA 40 ? ? 1.55 62 9 O A LEU 51 ? ? H A ALA 55 ? ? 1.58 63 9 O A THR 25 ? ? H A ARG 29 ? ? 1.59 64 9 O A ARG 39 ? ? N A ARG 41 ? ? 1.82 65 10 O A ARG 39 ? ? H A ARG 41 ? ? 0.90 66 10 O A THR 60 ? ? H A TYR 64 ? ? 1.55 67 10 O A LEU 51 ? ? H A ALA 55 ? ? 1.59 68 10 O A ARG 39 ? ? N A ARG 41 ? ? 1.83 69 11 HD21 A ASN 49 ? ? H A LEU 51 ? ? 1.02 70 11 O A ARG 39 ? ? H A ARG 41 ? ? 1.12 71 11 O A SER 57 ? ? H A ASN 61 ? ? 1.46 72 11 O A LYS 21 ? ? HG1 A THR 25 ? ? 1.49 73 11 O A THR 60 ? ? H A TYR 64 ? ? 1.51 74 11 OD1 A ASN 48 ? ? H A ASN 49 ? ? 1.51 75 11 O A LEU 51 ? ? H A ALA 55 ? ? 1.54 76 11 O A THR 25 ? ? H A ARG 29 ? ? 1.58 77 11 O A ARG 39 ? ? N A ARG 41 ? ? 1.95 78 12 O A ARG 39 ? ? H A ARG 41 ? ? 0.88 79 12 HZ1 A LYS 30 ? ? OE2 A GLU 31 ? ? 1.40 80 12 O A SER 57 ? ? H A ASN 61 ? ? 1.56 81 12 O A GLU 31 ? ? H A PHE 35 ? ? 1.58 82 12 O A LEU 51 ? ? H A ALA 55 ? ? 1.59 83 12 O A THR 60 ? ? H A TYR 64 ? ? 1.59 84 12 O A ARG 39 ? ? N A ARG 41 ? ? 1.81 85 13 HD21 A ASN 49 ? ? H A LEU 51 ? ? 0.97 86 13 O A ARG 39 ? ? H A ARG 41 ? ? 1.03 87 13 O A SER 57 ? ? H A ASN 61 ? ? 1.49 88 13 O A ARG 29 ? ? H A ALA 33 ? ? 1.50 89 13 O A ARG 65 ? ? H A THR 67 ? ? 1.53 90 13 O A THR 60 ? ? H A TYR 64 ? ? 1.54 91 13 O A LEU 51 ? ? H A ALA 55 ? ? 1.58 92 13 O A ARG 39 ? ? N A ARG 41 ? ? 1.91 93 14 O A ARG 39 ? ? H A ARG 41 ? ? 0.94 94 14 HD21 A ASN 49 ? ? H A LEU 51 ? ? 0.99 95 14 O A ARG 29 ? ? H A ALA 33 ? ? 1.53 96 14 O A LEU 51 ? ? H A ALA 55 ? ? 1.54 97 14 OD1 A ASN 48 ? ? H A ASN 49 ? ? 1.58 98 14 O A THR 60 ? ? H A TYR 64 ? ? 1.59 99 14 O A ARG 39 ? ? N A ARG 41 ? ? 1.85 100 15 HD21 A ASN 49 ? ? H A LEU 51 ? ? 0.98 101 15 O A ARG 39 ? ? H A ARG 41 ? ? 1.01 102 15 O A ARG 29 ? ? H A ALA 33 ? ? 1.50 103 15 O A SER 57 ? ? H A ASN 61 ? ? 1.53 104 15 O A LEU 23 ? ? H A HIS 27 ? ? 1.55 105 15 O A THR 60 ? ? H A TYR 64 ? ? 1.56 106 15 O A LEU 51 ? ? H A ALA 55 ? ? 1.57 107 15 O A ARG 39 ? ? N A ARG 41 ? ? 1.89 108 16 O A ARG 39 ? ? H A ARG 41 ? ? 0.81 109 16 O A ARG 29 ? ? H A ALA 33 ? ? 1.46 110 16 O A THR 60 ? ? H A TYR 64 ? ? 1.51 111 16 O A LEU 51 ? ? H A ALA 55 ? ? 1.55 112 16 O A ARG 39 ? ? N A ARG 41 ? ? 1.76 113 17 O A ARG 39 ? ? H A ARG 41 ? ? 0.87 114 17 O A GLU 31 ? ? H A PHE 35 ? ? 1.46 115 17 O A SER 57 ? ? H A ASN 61 ? ? 1.47 116 17 O A THR 60 ? ? H A TYR 64 ? ? 1.50 117 17 O A ARG 29 ? ? H A ALA 33 ? ? 1.53 118 17 O A GLU 36 ? ? H A ALA 40 ? ? 1.57 119 17 O A ARG 39 ? ? N A ARG 41 ? ? 1.81 120 18 O A ARG 39 ? ? H A ALA 42 ? ? 1.38 121 18 O A ARG 29 ? ? H A ALA 33 ? ? 1.47 122 18 O A SER 57 ? ? H A ASN 61 ? ? 1.56 123 18 O A THR 60 ? ? H A TYR 64 ? ? 1.59 124 19 O A ARG 39 ? ? H A ARG 41 ? ? 0.94 125 19 O A ARG 29 ? ? H A ALA 33 ? ? 1.44 126 19 O A THR 25 ? ? H A ARG 29 ? ? 1.47 127 19 O A SER 57 ? ? H A ASN 61 ? ? 1.51 128 19 O A THR 60 ? ? H A TYR 64 ? ? 1.56 129 19 O A LEU 51 ? ? H A ALA 55 ? ? 1.60 130 19 O A ARG 39 ? ? N A ARG 41 ? ? 1.85 131 20 HD21 A ASN 49 ? ? H A LEU 51 ? ? 1.02 132 20 O A ARG 39 ? ? H A ARG 41 ? ? 1.03 133 20 O A LEU 51 ? ? H A ALA 55 ? ? 1.54 134 20 OD1 A ASN 48 ? ? H A ASN 49 ? ? 1.54 135 20 O A SER 57 ? ? H A ASN 61 ? ? 1.59 136 20 O A ARG 39 ? ? N A ARG 41 ? ? 1.89 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 29 ? ? -49.79 -15.65 2 1 ALA A 40 ? ? -27.45 15.67 3 1 ALA A 42 ? ? -64.71 3.68 4 1 TRP A 44 ? ? -144.97 25.24 5 1 ASP A 45 ? ? -176.19 -76.23 6 1 THR A 46 ? ? 79.31 -42.78 7 1 ASN A 48 ? ? -7.87 -109.62 8 1 PRO A 50 ? ? -55.26 -9.09 9 1 ASN A 61 ? ? -57.67 -8.02 10 1 TYR A 64 ? ? -52.39 -7.87 11 1 ARG A 65 ? ? -63.89 1.41 12 2 ARG A 29 ? ? -49.65 -14.85 13 2 ALA A 40 ? ? -26.34 15.55 14 2 TRP A 44 ? ? -148.16 19.95 15 2 ASP A 45 ? ? -172.17 -70.26 16 2 THR A 46 ? ? 81.08 -35.47 17 2 ASN A 48 ? ? 23.74 -126.39 18 2 PRO A 50 ? ? -48.39 -10.16 19 2 ASN A 61 ? ? -58.63 -7.53 20 3 ALA A 40 ? ? -30.00 14.74 21 3 TRP A 44 ? ? -148.62 21.75 22 3 ASP A 45 ? ? -175.64 -68.39 23 3 THR A 46 ? ? 80.30 -40.87 24 3 ASN A 48 ? ? 30.60 -114.29 25 3 PRO A 50 ? ? -50.47 -7.50 26 3 ASN A 61 ? ? -56.60 -7.90 27 4 ALA A 40 ? ? -46.32 3.22 28 4 TRP A 44 ? ? -149.49 20.74 29 4 ASP A 45 ? ? -175.41 -68.57 30 4 THR A 46 ? ? 81.89 -40.06 31 4 ASN A 48 ? ? 33.57 -120.61 32 4 PRO A 50 ? ? -47.54 -10.93 33 4 ASN A 61 ? ? -58.96 -7.53 34 5 ARG A 29 ? ? -49.08 -15.34 35 5 ALA A 40 ? ? -26.71 14.78 36 5 TRP A 44 ? ? -147.21 20.46 37 5 ASP A 45 ? ? -172.42 -70.47 38 5 THR A 46 ? ? 80.40 -34.96 39 5 ASN A 48 ? ? 20.14 -128.60 40 5 PRO A 50 ? ? -48.61 -7.75 41 5 ASN A 61 ? ? -54.67 -9.20 42 5 TYR A 64 ? ? -49.59 -7.53 43 6 ALA A 40 ? ? -29.28 15.64 44 6 ALA A 42 ? ? -64.60 3.58 45 6 TRP A 44 ? ? -148.24 20.02 46 6 ASP A 45 ? ? -174.54 -68.96 47 6 THR A 46 ? ? 82.97 -40.74 48 6 ASN A 48 ? ? 37.78 -95.95 49 6 PRO A 50 ? ? -44.65 -7.03 50 6 ASN A 61 ? ? -58.92 -8.01 51 6 TYR A 64 ? ? -51.52 -8.79 52 7 ALA A 40 ? ? -26.16 16.94 53 7 ALA A 42 ? ? -64.83 3.41 54 7 TRP A 44 ? ? -148.21 20.27 55 7 ASP A 45 ? ? -174.70 -70.04 56 7 THR A 46 ? ? 83.49 -37.84 57 7 ASN A 48 ? ? 28.09 -125.02 58 7 PRO A 50 ? ? -50.19 -6.26 59 7 ASN A 61 ? ? -59.36 -7.73 60 7 ARG A 65 ? ? -68.99 8.79 61 8 HIS A 27 ? ? -49.97 -12.70 62 8 ALA A 40 ? ? -48.04 5.28 63 8 ALA A 42 ? ? -65.14 4.01 64 8 TRP A 44 ? ? -146.96 21.41 65 8 ASP A 45 ? ? -176.40 -71.16 66 8 THR A 46 ? ? 84.30 -38.49 67 8 ASN A 48 ? ? 32.82 -122.74 68 8 PRO A 50 ? ? -46.69 -13.00 69 8 TYR A 64 ? ? -50.62 -9.97 70 9 ALA A 40 ? ? -27.35 15.29 71 9 TRP A 44 ? ? -148.90 20.58 72 9 ASP A 45 ? ? -173.94 -69.15 73 9 THR A 46 ? ? 81.58 -37.76 74 9 ASN A 48 ? ? 24.65 -125.49 75 9 PRO A 50 ? ? -49.98 -6.71 76 9 ASN A 61 ? ? -56.87 -9.38 77 10 ALA A 40 ? ? -26.74 15.25 78 10 ALA A 42 ? ? -65.01 3.68 79 10 TRP A 44 ? ? -144.72 20.66 80 10 ASP A 45 ? ? -172.80 -73.72 81 10 THR A 46 ? ? 82.47 -34.71 82 10 ASN A 48 ? ? 21.22 -127.07 83 10 PRO A 50 ? ? -47.66 -11.05 84 10 ASN A 61 ? ? -58.58 -9.32 85 10 TYR A 64 ? ? -52.90 -8.63 86 11 ALA A 40 ? ? -34.45 12.80 87 11 TRP A 44 ? ? -149.64 21.23 88 11 ASP A 45 ? ? -175.72 -67.17 89 11 THR A 46 ? ? 81.50 -41.11 90 11 ASN A 48 ? ? 34.69 -101.12 91 11 PRO A 50 ? ? -45.87 -6.05 92 11 ASN A 61 ? ? -55.45 -7.55 93 11 TYR A 64 ? ? -54.08 -6.87 94 12 ALA A 40 ? ? -26.55 16.02 95 12 ALA A 42 ? ? -64.74 3.53 96 12 TRP A 44 ? ? -144.55 20.45 97 12 ASP A 45 ? ? -172.44 -73.99 98 12 THR A 46 ? ? 82.77 -34.95 99 12 ASN A 48 ? ? 22.17 -127.20 100 12 PRO A 50 ? ? -48.20 -10.26 101 12 TYR A 64 ? ? -49.93 -9.59 102 12 ARG A 65 ? ? -63.88 2.47 103 13 ALA A 40 ? ? -33.08 15.50 104 13 ALA A 42 ? ? -64.80 3.86 105 13 TRP A 44 ? ? -146.95 21.02 106 13 ASP A 45 ? ? -174.86 -69.23 107 13 THR A 46 ? ? 80.76 -43.11 108 13 ASN A 48 ? ? 36.16 -94.62 109 13 PRO A 50 ? ? -44.16 -8.14 110 13 ASN A 61 ? ? -56.79 -9.28 111 13 TYR A 64 ? ? -51.64 -8.44 112 14 ALA A 40 ? ? -28.40 14.30 113 14 TRP A 44 ? ? -149.56 20.13 114 14 ASP A 45 ? ? -174.34 -67.51 115 14 THR A 46 ? ? 81.17 -41.29 116 14 ASN A 48 ? ? 37.36 -94.10 117 14 PRO A 50 ? ? -43.15 -8.58 118 14 TYR A 64 ? ? -49.73 -9.67 119 15 ALA A 40 ? ? -31.06 13.81 120 15 ALA A 42 ? ? -64.53 3.51 121 15 TRP A 44 ? ? -146.22 21.40 122 15 ASP A 45 ? ? -175.10 -69.84 123 15 THR A 46 ? ? 80.93 -43.62 124 15 ASN A 48 ? ? 36.36 -95.04 125 15 PRO A 50 ? ? -45.01 -6.84 126 15 TYR A 64 ? ? -50.79 -9.58 127 16 ALA A 40 ? ? -23.71 16.78 128 16 ALA A 42 ? ? -64.89 3.72 129 16 TRP A 44 ? ? -145.80 20.80 130 16 ASP A 45 ? ? -173.26 -72.22 131 16 THR A 46 ? ? 80.52 -41.22 132 16 ASN A 48 ? ? 34.64 -92.35 133 16 PRO A 50 ? ? -47.22 -14.63 134 16 TYR A 64 ? ? -52.85 -9.02 135 17 ALA A 40 ? ? -26.32 16.78 136 17 ALA A 42 ? ? -64.85 3.77 137 17 TRP A 44 ? ? -145.50 19.91 138 17 ASP A 45 ? ? -172.58 -72.99 139 17 THR A 46 ? ? 82.99 -34.83 140 17 ASN A 48 ? ? 22.55 -128.65 141 17 PRO A 50 ? ? -47.99 -9.20 142 17 THR A 58 ? ? -49.73 -17.40 143 17 ASN A 61 ? ? -53.88 -8.83 144 17 TYR A 64 ? ? -51.54 -8.58 145 17 ARG A 65 ? ? -64.79 3.06 146 18 ALA A 40 ? ? -48.09 1.40 147 18 TRP A 44 ? ? -150.74 21.06 148 18 ASP A 45 ? ? -175.01 -68.89 149 18 THR A 46 ? ? 82.80 -40.16 150 18 ASN A 48 ? ? 16.83 -125.83 151 18 PRO A 50 ? ? -52.17 -4.83 152 18 TYR A 64 ? ? -49.69 -10.19 153 19 ALA A 40 ? ? -28.01 14.72 154 19 TRP A 44 ? ? -146.48 22.06 155 19 ASP A 45 ? ? -173.20 -70.37 156 19 THR A 46 ? ? 78.68 -40.03 157 19 ASN A 48 ? ? 31.85 -93.99 158 19 PRO A 50 ? ? -48.62 -13.42 159 19 ASN A 61 ? ? -59.75 -9.29 160 19 TYR A 64 ? ? -50.57 -9.39 161 20 HIS A 27 ? ? -47.37 -15.09 162 20 ARG A 29 ? ? -47.39 -15.59 163 20 ALA A 40 ? ? -32.42 13.83 164 20 TRP A 44 ? ? -149.48 20.15 165 20 ASP A 45 ? ? -174.37 -66.75 166 20 THR A 46 ? ? 80.74 -41.59 167 20 ASN A 48 ? ? 35.55 -93.84 168 20 PRO A 50 ? ? -45.07 -6.16 169 20 TYR A 64 ? ? -49.06 -10.69 170 20 ARG A 65 ? ? -63.78 0.91 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A HIS 4 ? A HIS 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A HIS 8 ? A HIS 8 9 1 Y 1 A HIS 9 ? A HIS 9 10 1 Y 1 A SER 10 ? A SER 10 11 1 Y 1 A SER 11 ? A SER 11 12 1 Y 1 A GLY 12 ? A GLY 12 13 1 Y 1 A LEU 13 ? A LEU 13 14 1 Y 1 A VAL 14 ? A VAL 14 15 1 Y 1 A PRO 15 ? A PRO 15 16 1 Y 1 A ARG 16 ? A ARG 16 17 1 Y 1 A GLY 17 ? A GLY 17 18 1 Y 1 A SER 18 ? A SER 18 19 1 Y 1 A HIS 19 ? A HIS 19 20 1 Y 1 A MET 20 ? A MET 20 21 2 Y 1 A GLY 1 ? A GLY 1 22 2 Y 1 A SER 2 ? A SER 2 23 2 Y 1 A SER 3 ? A SER 3 24 2 Y 1 A HIS 4 ? A HIS 4 25 2 Y 1 A HIS 5 ? A HIS 5 26 2 Y 1 A HIS 6 ? A HIS 6 27 2 Y 1 A HIS 7 ? A HIS 7 28 2 Y 1 A HIS 8 ? A HIS 8 29 2 Y 1 A HIS 9 ? A HIS 9 30 2 Y 1 A SER 10 ? A SER 10 31 2 Y 1 A SER 11 ? A SER 11 32 2 Y 1 A GLY 12 ? A GLY 12 33 2 Y 1 A LEU 13 ? A LEU 13 34 2 Y 1 A VAL 14 ? A VAL 14 35 2 Y 1 A PRO 15 ? A PRO 15 36 2 Y 1 A ARG 16 ? A ARG 16 37 2 Y 1 A GLY 17 ? A GLY 17 38 2 Y 1 A SER 18 ? A SER 18 39 2 Y 1 A HIS 19 ? A HIS 19 40 2 Y 1 A MET 20 ? A MET 20 41 3 Y 1 A GLY 1 ? A GLY 1 42 3 Y 1 A SER 2 ? A SER 2 43 3 Y 1 A SER 3 ? A SER 3 44 3 Y 1 A HIS 4 ? A HIS 4 45 3 Y 1 A HIS 5 ? A HIS 5 46 3 Y 1 A HIS 6 ? A HIS 6 47 3 Y 1 A HIS 7 ? A HIS 7 48 3 Y 1 A HIS 8 ? A HIS 8 49 3 Y 1 A HIS 9 ? A HIS 9 50 3 Y 1 A SER 10 ? A SER 10 51 3 Y 1 A SER 11 ? A SER 11 52 3 Y 1 A GLY 12 ? A GLY 12 53 3 Y 1 A LEU 13 ? A LEU 13 54 3 Y 1 A VAL 14 ? A VAL 14 55 3 Y 1 A PRO 15 ? A PRO 15 56 3 Y 1 A ARG 16 ? A ARG 16 57 3 Y 1 A GLY 17 ? A GLY 17 58 3 Y 1 A SER 18 ? A SER 18 59 3 Y 1 A HIS 19 ? A HIS 19 60 3 Y 1 A MET 20 ? A MET 20 61 4 Y 1 A GLY 1 ? A GLY 1 62 4 Y 1 A SER 2 ? A SER 2 63 4 Y 1 A SER 3 ? A SER 3 64 4 Y 1 A HIS 4 ? A HIS 4 65 4 Y 1 A HIS 5 ? A HIS 5 66 4 Y 1 A HIS 6 ? A HIS 6 67 4 Y 1 A HIS 7 ? A HIS 7 68 4 Y 1 A HIS 8 ? A HIS 8 69 4 Y 1 A HIS 9 ? A HIS 9 70 4 Y 1 A SER 10 ? A SER 10 71 4 Y 1 A SER 11 ? A SER 11 72 4 Y 1 A GLY 12 ? A GLY 12 73 4 Y 1 A LEU 13 ? A LEU 13 74 4 Y 1 A VAL 14 ? A VAL 14 75 4 Y 1 A PRO 15 ? A PRO 15 76 4 Y 1 A ARG 16 ? A ARG 16 77 4 Y 1 A GLY 17 ? A GLY 17 78 4 Y 1 A SER 18 ? A SER 18 79 4 Y 1 A HIS 19 ? A HIS 19 80 4 Y 1 A MET 20 ? A MET 20 81 5 Y 1 A GLY 1 ? A GLY 1 82 5 Y 1 A SER 2 ? A SER 2 83 5 Y 1 A SER 3 ? A SER 3 84 5 Y 1 A HIS 4 ? A HIS 4 85 5 Y 1 A HIS 5 ? A HIS 5 86 5 Y 1 A HIS 6 ? A HIS 6 87 5 Y 1 A HIS 7 ? A HIS 7 88 5 Y 1 A HIS 8 ? A HIS 8 89 5 Y 1 A HIS 9 ? A HIS 9 90 5 Y 1 A SER 10 ? A SER 10 91 5 Y 1 A SER 11 ? A SER 11 92 5 Y 1 A GLY 12 ? A GLY 12 93 5 Y 1 A LEU 13 ? A LEU 13 94 5 Y 1 A VAL 14 ? A VAL 14 95 5 Y 1 A PRO 15 ? A PRO 15 96 5 Y 1 A ARG 16 ? A ARG 16 97 5 Y 1 A GLY 17 ? A GLY 17 98 5 Y 1 A SER 18 ? A SER 18 99 5 Y 1 A HIS 19 ? A HIS 19 100 5 Y 1 A MET 20 ? A MET 20 101 6 Y 1 A GLY 1 ? A GLY 1 102 6 Y 1 A SER 2 ? A SER 2 103 6 Y 1 A SER 3 ? A SER 3 104 6 Y 1 A HIS 4 ? A HIS 4 105 6 Y 1 A HIS 5 ? A HIS 5 106 6 Y 1 A HIS 6 ? A HIS 6 107 6 Y 1 A HIS 7 ? A HIS 7 108 6 Y 1 A HIS 8 ? A HIS 8 109 6 Y 1 A HIS 9 ? A HIS 9 110 6 Y 1 A SER 10 ? A SER 10 111 6 Y 1 A SER 11 ? A SER 11 112 6 Y 1 A GLY 12 ? A GLY 12 113 6 Y 1 A LEU 13 ? A LEU 13 114 6 Y 1 A VAL 14 ? A VAL 14 115 6 Y 1 A PRO 15 ? A PRO 15 116 6 Y 1 A ARG 16 ? A ARG 16 117 6 Y 1 A GLY 17 ? A GLY 17 118 6 Y 1 A SER 18 ? A SER 18 119 6 Y 1 A HIS 19 ? A HIS 19 120 6 Y 1 A MET 20 ? A MET 20 121 7 Y 1 A GLY 1 ? A GLY 1 122 7 Y 1 A SER 2 ? A SER 2 123 7 Y 1 A SER 3 ? A SER 3 124 7 Y 1 A HIS 4 ? A HIS 4 125 7 Y 1 A HIS 5 ? A HIS 5 126 7 Y 1 A HIS 6 ? A HIS 6 127 7 Y 1 A HIS 7 ? A HIS 7 128 7 Y 1 A HIS 8 ? A HIS 8 129 7 Y 1 A HIS 9 ? A HIS 9 130 7 Y 1 A SER 10 ? A SER 10 131 7 Y 1 A SER 11 ? A SER 11 132 7 Y 1 A GLY 12 ? A GLY 12 133 7 Y 1 A LEU 13 ? A LEU 13 134 7 Y 1 A VAL 14 ? A VAL 14 135 7 Y 1 A PRO 15 ? A PRO 15 136 7 Y 1 A ARG 16 ? A ARG 16 137 7 Y 1 A GLY 17 ? A GLY 17 138 7 Y 1 A SER 18 ? A SER 18 139 7 Y 1 A HIS 19 ? A HIS 19 140 7 Y 1 A MET 20 ? A MET 20 141 8 Y 1 A GLY 1 ? A GLY 1 142 8 Y 1 A SER 2 ? A SER 2 143 8 Y 1 A SER 3 ? A SER 3 144 8 Y 1 A HIS 4 ? A HIS 4 145 8 Y 1 A HIS 5 ? A HIS 5 146 8 Y 1 A HIS 6 ? A HIS 6 147 8 Y 1 A HIS 7 ? A HIS 7 148 8 Y 1 A HIS 8 ? A HIS 8 149 8 Y 1 A HIS 9 ? A HIS 9 150 8 Y 1 A SER 10 ? A SER 10 151 8 Y 1 A SER 11 ? A SER 11 152 8 Y 1 A GLY 12 ? A GLY 12 153 8 Y 1 A LEU 13 ? A LEU 13 154 8 Y 1 A VAL 14 ? A VAL 14 155 8 Y 1 A PRO 15 ? A PRO 15 156 8 Y 1 A ARG 16 ? A ARG 16 157 8 Y 1 A GLY 17 ? A GLY 17 158 8 Y 1 A SER 18 ? A SER 18 159 8 Y 1 A HIS 19 ? A HIS 19 160 8 Y 1 A MET 20 ? A MET 20 161 9 Y 1 A GLY 1 ? A GLY 1 162 9 Y 1 A SER 2 ? A SER 2 163 9 Y 1 A SER 3 ? A SER 3 164 9 Y 1 A HIS 4 ? A HIS 4 165 9 Y 1 A HIS 5 ? A HIS 5 166 9 Y 1 A HIS 6 ? A HIS 6 167 9 Y 1 A HIS 7 ? A HIS 7 168 9 Y 1 A HIS 8 ? A HIS 8 169 9 Y 1 A HIS 9 ? A HIS 9 170 9 Y 1 A SER 10 ? A SER 10 171 9 Y 1 A SER 11 ? A SER 11 172 9 Y 1 A GLY 12 ? A GLY 12 173 9 Y 1 A LEU 13 ? A LEU 13 174 9 Y 1 A VAL 14 ? A VAL 14 175 9 Y 1 A PRO 15 ? A PRO 15 176 9 Y 1 A ARG 16 ? A ARG 16 177 9 Y 1 A GLY 17 ? A GLY 17 178 9 Y 1 A SER 18 ? A SER 18 179 9 Y 1 A HIS 19 ? A HIS 19 180 9 Y 1 A MET 20 ? A MET 20 181 10 Y 1 A GLY 1 ? A GLY 1 182 10 Y 1 A SER 2 ? A SER 2 183 10 Y 1 A SER 3 ? A SER 3 184 10 Y 1 A HIS 4 ? A HIS 4 185 10 Y 1 A HIS 5 ? A HIS 5 186 10 Y 1 A HIS 6 ? A HIS 6 187 10 Y 1 A HIS 7 ? A HIS 7 188 10 Y 1 A HIS 8 ? A HIS 8 189 10 Y 1 A HIS 9 ? A HIS 9 190 10 Y 1 A SER 10 ? A SER 10 191 10 Y 1 A SER 11 ? A SER 11 192 10 Y 1 A GLY 12 ? A GLY 12 193 10 Y 1 A LEU 13 ? A LEU 13 194 10 Y 1 A VAL 14 ? A VAL 14 195 10 Y 1 A PRO 15 ? A PRO 15 196 10 Y 1 A ARG 16 ? A ARG 16 197 10 Y 1 A GLY 17 ? A GLY 17 198 10 Y 1 A SER 18 ? A SER 18 199 10 Y 1 A HIS 19 ? A HIS 19 200 10 Y 1 A MET 20 ? A MET 20 201 11 Y 1 A GLY 1 ? A GLY 1 202 11 Y 1 A SER 2 ? A SER 2 203 11 Y 1 A SER 3 ? A SER 3 204 11 Y 1 A HIS 4 ? A HIS 4 205 11 Y 1 A HIS 5 ? A HIS 5 206 11 Y 1 A HIS 6 ? A HIS 6 207 11 Y 1 A HIS 7 ? A HIS 7 208 11 Y 1 A HIS 8 ? A HIS 8 209 11 Y 1 A HIS 9 ? A HIS 9 210 11 Y 1 A SER 10 ? A SER 10 211 11 Y 1 A SER 11 ? A SER 11 212 11 Y 1 A GLY 12 ? A GLY 12 213 11 Y 1 A LEU 13 ? A LEU 13 214 11 Y 1 A VAL 14 ? A VAL 14 215 11 Y 1 A PRO 15 ? A PRO 15 216 11 Y 1 A ARG 16 ? A ARG 16 217 11 Y 1 A GLY 17 ? A GLY 17 218 11 Y 1 A SER 18 ? A SER 18 219 11 Y 1 A HIS 19 ? A HIS 19 220 11 Y 1 A MET 20 ? A MET 20 221 12 Y 1 A GLY 1 ? A GLY 1 222 12 Y 1 A SER 2 ? A SER 2 223 12 Y 1 A SER 3 ? A SER 3 224 12 Y 1 A HIS 4 ? A HIS 4 225 12 Y 1 A HIS 5 ? A HIS 5 226 12 Y 1 A HIS 6 ? A HIS 6 227 12 Y 1 A HIS 7 ? A HIS 7 228 12 Y 1 A HIS 8 ? A HIS 8 229 12 Y 1 A HIS 9 ? A HIS 9 230 12 Y 1 A SER 10 ? A SER 10 231 12 Y 1 A SER 11 ? A SER 11 232 12 Y 1 A GLY 12 ? A GLY 12 233 12 Y 1 A LEU 13 ? A LEU 13 234 12 Y 1 A VAL 14 ? A VAL 14 235 12 Y 1 A PRO 15 ? A PRO 15 236 12 Y 1 A ARG 16 ? A ARG 16 237 12 Y 1 A GLY 17 ? A GLY 17 238 12 Y 1 A SER 18 ? A SER 18 239 12 Y 1 A HIS 19 ? A HIS 19 240 12 Y 1 A MET 20 ? A MET 20 241 13 Y 1 A GLY 1 ? A GLY 1 242 13 Y 1 A SER 2 ? A SER 2 243 13 Y 1 A SER 3 ? A SER 3 244 13 Y 1 A HIS 4 ? A HIS 4 245 13 Y 1 A HIS 5 ? A HIS 5 246 13 Y 1 A HIS 6 ? A HIS 6 247 13 Y 1 A HIS 7 ? A HIS 7 248 13 Y 1 A HIS 8 ? A HIS 8 249 13 Y 1 A HIS 9 ? A HIS 9 250 13 Y 1 A SER 10 ? A SER 10 251 13 Y 1 A SER 11 ? A SER 11 252 13 Y 1 A GLY 12 ? A GLY 12 253 13 Y 1 A LEU 13 ? A LEU 13 254 13 Y 1 A VAL 14 ? A VAL 14 255 13 Y 1 A PRO 15 ? A PRO 15 256 13 Y 1 A ARG 16 ? A ARG 16 257 13 Y 1 A GLY 17 ? A GLY 17 258 13 Y 1 A SER 18 ? A SER 18 259 13 Y 1 A HIS 19 ? A HIS 19 260 13 Y 1 A MET 20 ? A MET 20 261 14 Y 1 A GLY 1 ? A GLY 1 262 14 Y 1 A SER 2 ? A SER 2 263 14 Y 1 A SER 3 ? A SER 3 264 14 Y 1 A HIS 4 ? A HIS 4 265 14 Y 1 A HIS 5 ? A HIS 5 266 14 Y 1 A HIS 6 ? A HIS 6 267 14 Y 1 A HIS 7 ? A HIS 7 268 14 Y 1 A HIS 8 ? A HIS 8 269 14 Y 1 A HIS 9 ? A HIS 9 270 14 Y 1 A SER 10 ? A SER 10 271 14 Y 1 A SER 11 ? A SER 11 272 14 Y 1 A GLY 12 ? A GLY 12 273 14 Y 1 A LEU 13 ? A LEU 13 274 14 Y 1 A VAL 14 ? A VAL 14 275 14 Y 1 A PRO 15 ? A PRO 15 276 14 Y 1 A ARG 16 ? A ARG 16 277 14 Y 1 A GLY 17 ? A GLY 17 278 14 Y 1 A SER 18 ? A SER 18 279 14 Y 1 A HIS 19 ? A HIS 19 280 14 Y 1 A MET 20 ? A MET 20 281 15 Y 1 A GLY 1 ? A GLY 1 282 15 Y 1 A SER 2 ? A SER 2 283 15 Y 1 A SER 3 ? A SER 3 284 15 Y 1 A HIS 4 ? A HIS 4 285 15 Y 1 A HIS 5 ? A HIS 5 286 15 Y 1 A HIS 6 ? A HIS 6 287 15 Y 1 A HIS 7 ? A HIS 7 288 15 Y 1 A HIS 8 ? A HIS 8 289 15 Y 1 A HIS 9 ? A HIS 9 290 15 Y 1 A SER 10 ? A SER 10 291 15 Y 1 A SER 11 ? A SER 11 292 15 Y 1 A GLY 12 ? A GLY 12 293 15 Y 1 A LEU 13 ? A LEU 13 294 15 Y 1 A VAL 14 ? A VAL 14 295 15 Y 1 A PRO 15 ? A PRO 15 296 15 Y 1 A ARG 16 ? A ARG 16 297 15 Y 1 A GLY 17 ? A GLY 17 298 15 Y 1 A SER 18 ? A SER 18 299 15 Y 1 A HIS 19 ? A HIS 19 300 15 Y 1 A MET 20 ? A MET 20 301 16 Y 1 A GLY 1 ? A GLY 1 302 16 Y 1 A SER 2 ? A SER 2 303 16 Y 1 A SER 3 ? A SER 3 304 16 Y 1 A HIS 4 ? A HIS 4 305 16 Y 1 A HIS 5 ? A HIS 5 306 16 Y 1 A HIS 6 ? A HIS 6 307 16 Y 1 A HIS 7 ? A HIS 7 308 16 Y 1 A HIS 8 ? A HIS 8 309 16 Y 1 A HIS 9 ? A HIS 9 310 16 Y 1 A SER 10 ? A SER 10 311 16 Y 1 A SER 11 ? A SER 11 312 16 Y 1 A GLY 12 ? A GLY 12 313 16 Y 1 A LEU 13 ? A LEU 13 314 16 Y 1 A VAL 14 ? A VAL 14 315 16 Y 1 A PRO 15 ? A PRO 15 316 16 Y 1 A ARG 16 ? A ARG 16 317 16 Y 1 A GLY 17 ? A GLY 17 318 16 Y 1 A SER 18 ? A SER 18 319 16 Y 1 A HIS 19 ? A HIS 19 320 16 Y 1 A MET 20 ? A MET 20 321 17 Y 1 A GLY 1 ? A GLY 1 322 17 Y 1 A SER 2 ? A SER 2 323 17 Y 1 A SER 3 ? A SER 3 324 17 Y 1 A HIS 4 ? A HIS 4 325 17 Y 1 A HIS 5 ? A HIS 5 326 17 Y 1 A HIS 6 ? A HIS 6 327 17 Y 1 A HIS 7 ? A HIS 7 328 17 Y 1 A HIS 8 ? A HIS 8 329 17 Y 1 A HIS 9 ? A HIS 9 330 17 Y 1 A SER 10 ? A SER 10 331 17 Y 1 A SER 11 ? A SER 11 332 17 Y 1 A GLY 12 ? A GLY 12 333 17 Y 1 A LEU 13 ? A LEU 13 334 17 Y 1 A VAL 14 ? A VAL 14 335 17 Y 1 A PRO 15 ? A PRO 15 336 17 Y 1 A ARG 16 ? A ARG 16 337 17 Y 1 A GLY 17 ? A GLY 17 338 17 Y 1 A SER 18 ? A SER 18 339 17 Y 1 A HIS 19 ? A HIS 19 340 17 Y 1 A MET 20 ? A MET 20 341 18 Y 1 A GLY 1 ? A GLY 1 342 18 Y 1 A SER 2 ? A SER 2 343 18 Y 1 A SER 3 ? A SER 3 344 18 Y 1 A HIS 4 ? A HIS 4 345 18 Y 1 A HIS 5 ? A HIS 5 346 18 Y 1 A HIS 6 ? A HIS 6 347 18 Y 1 A HIS 7 ? A HIS 7 348 18 Y 1 A HIS 8 ? A HIS 8 349 18 Y 1 A HIS 9 ? A HIS 9 350 18 Y 1 A SER 10 ? A SER 10 351 18 Y 1 A SER 11 ? A SER 11 352 18 Y 1 A GLY 12 ? A GLY 12 353 18 Y 1 A LEU 13 ? A LEU 13 354 18 Y 1 A VAL 14 ? A VAL 14 355 18 Y 1 A PRO 15 ? A PRO 15 356 18 Y 1 A ARG 16 ? A ARG 16 357 18 Y 1 A GLY 17 ? A GLY 17 358 18 Y 1 A SER 18 ? A SER 18 359 18 Y 1 A HIS 19 ? A HIS 19 360 18 Y 1 A MET 20 ? A MET 20 361 19 Y 1 A GLY 1 ? A GLY 1 362 19 Y 1 A SER 2 ? A SER 2 363 19 Y 1 A SER 3 ? A SER 3 364 19 Y 1 A HIS 4 ? A HIS 4 365 19 Y 1 A HIS 5 ? A HIS 5 366 19 Y 1 A HIS 6 ? A HIS 6 367 19 Y 1 A HIS 7 ? A HIS 7 368 19 Y 1 A HIS 8 ? A HIS 8 369 19 Y 1 A HIS 9 ? A HIS 9 370 19 Y 1 A SER 10 ? A SER 10 371 19 Y 1 A SER 11 ? A SER 11 372 19 Y 1 A GLY 12 ? A GLY 12 373 19 Y 1 A LEU 13 ? A LEU 13 374 19 Y 1 A VAL 14 ? A VAL 14 375 19 Y 1 A PRO 15 ? A PRO 15 376 19 Y 1 A ARG 16 ? A ARG 16 377 19 Y 1 A GLY 17 ? A GLY 17 378 19 Y 1 A SER 18 ? A SER 18 379 19 Y 1 A HIS 19 ? A HIS 19 380 19 Y 1 A MET 20 ? A MET 20 381 20 Y 1 A GLY 1 ? A GLY 1 382 20 Y 1 A SER 2 ? A SER 2 383 20 Y 1 A SER 3 ? A SER 3 384 20 Y 1 A HIS 4 ? A HIS 4 385 20 Y 1 A HIS 5 ? A HIS 5 386 20 Y 1 A HIS 6 ? A HIS 6 387 20 Y 1 A HIS 7 ? A HIS 7 388 20 Y 1 A HIS 8 ? A HIS 8 389 20 Y 1 A HIS 9 ? A HIS 9 390 20 Y 1 A SER 10 ? A SER 10 391 20 Y 1 A SER 11 ? A SER 11 392 20 Y 1 A GLY 12 ? A GLY 12 393 20 Y 1 A LEU 13 ? A LEU 13 394 20 Y 1 A VAL 14 ? A VAL 14 395 20 Y 1 A PRO 15 ? A PRO 15 396 20 Y 1 A ARG 16 ? A ARG 16 397 20 Y 1 A GLY 17 ? A GLY 17 398 20 Y 1 A SER 18 ? A SER 18 399 20 Y 1 A HIS 19 ? A HIS 19 400 20 Y 1 A MET 20 ? A MET 20 #