data_1SE7 # _entry.id 1SE7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1SE7 pdb_00001se7 10.2210/pdb1se7/pdb RCSB RCSB021633 ? ? WWPDB D_1000021633 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1SE7 _pdbx_database_status.recvd_initial_deposition_date 2004-02-16 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'DeRose, E.F.' 1 'Kirby, T.W.' 2 'Mueller, G.A.' 3 'Chikova, A.K.' 4 'Schaaper, R.M.' 5 'London, R.E.' 6 # _citation.id primary _citation.title ;Phage Like It HOT: Solution Structure of the Bacteriophage P1-Encoded HOT Protein, a Homolog of the theta Subunit of E. coli DNA Polymerase III ; _citation.journal_abbrev Structure _citation.journal_volume 12 _citation.page_first 2221 _citation.page_last 2231 _citation.year 2004 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15576035 _citation.pdbx_database_id_DOI 10.1016/j.str.2004.09.019 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Derose, E.F.' 1 ? primary 'Kirby, T.W.' 2 ? primary 'Mueller, G.A.' 3 ? primary 'Chikova, A.K.' 4 ? primary 'Schaaper, R.M.' 5 ? primary 'London, R.E.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'HOMOLOGUE OF THE THETA SUBUNIT OF DNA POLYMERASE III' _entity.formula_weight 9709.967 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name HOT # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MYDWNIAAKSQEERDKVNVDLAASGVAYKERLNIPVIAEQVAREQPENLRTYFMERLRHYRQLSLQLPKGSDPAYQKDDA VKK ; _entity_poly.pdbx_seq_one_letter_code_can ;MYDWNIAAKSQEERDKVNVDLAASGVAYKERLNIPVIAEQVAREQPENLRTYFMERLRHYRQLSLQLPKGSDPAYQKDDA VKK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 TYR n 1 3 ASP n 1 4 TRP n 1 5 ASN n 1 6 ILE n 1 7 ALA n 1 8 ALA n 1 9 LYS n 1 10 SER n 1 11 GLN n 1 12 GLU n 1 13 GLU n 1 14 ARG n 1 15 ASP n 1 16 LYS n 1 17 VAL n 1 18 ASN n 1 19 VAL n 1 20 ASP n 1 21 LEU n 1 22 ALA n 1 23 ALA n 1 24 SER n 1 25 GLY n 1 26 VAL n 1 27 ALA n 1 28 TYR n 1 29 LYS n 1 30 GLU n 1 31 ARG n 1 32 LEU n 1 33 ASN n 1 34 ILE n 1 35 PRO n 1 36 VAL n 1 37 ILE n 1 38 ALA n 1 39 GLU n 1 40 GLN n 1 41 VAL n 1 42 ALA n 1 43 ARG n 1 44 GLU n 1 45 GLN n 1 46 PRO n 1 47 GLU n 1 48 ASN n 1 49 LEU n 1 50 ARG n 1 51 THR n 1 52 TYR n 1 53 PHE n 1 54 MET n 1 55 GLU n 1 56 ARG n 1 57 LEU n 1 58 ARG n 1 59 HIS n 1 60 TYR n 1 61 ARG n 1 62 GLN n 1 63 LEU n 1 64 SER n 1 65 LEU n 1 66 GLN n 1 67 LEU n 1 68 PRO n 1 69 LYS n 1 70 GLY n 1 71 SER n 1 72 ASP n 1 73 PRO n 1 74 ALA n 1 75 TYR n 1 76 GLN n 1 77 LYS n 1 78 ASP n 1 79 ASP n 1 80 ALA n 1 81 VAL n 1 82 LYS n 1 83 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus 'P1-like viruses' _entity_src_gen.pdbx_gene_src_gene HOT _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage P1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10678 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BLR(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET30HOT _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code Q71T70_BPP1 _struct_ref.pdbx_db_accession Q71T70 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1SE7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 83 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q71T70 _struct_ref_seq.db_align_beg 5 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 87 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 83 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.3mM U-[13C,15N] protein, 5mM Tris, 100mM NaCl, 5mM NaN3' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1SE7 _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics, torsion angle dynamics' _pdbx_nmr_refine.details ;The structures were computed using default ARIA parameters, with qrelax set to false. 430 manually assigned NOE distance restraints were included, and qshift and qexclude were set to false for the manually assigned NOEs. ARIA assigned 1140 unambiguous and 435 ambiguous NOE distance restraints. 51 dihedral restraints, 46 hydrogen bond restraints, and 36 backbone amide residual dipolar couplings were also used in the calculation. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1SE7 _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_ensemble.entry_id 1SE7 _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 7 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1SE7 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal NMRPipe '2.1 Rev 2002.044.17.08' processing ? 1 NMRView 5.0.4 'data analysis' ? 2 ARIA 1.2 'structure solution' ? 3 CNS 1.1 'structure solution' ? 4 CNS 1.1 refinement ? 5 # _exptl.entry_id 1SE7 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1SE7 _struct.title ;Solution structure of the E. coli bacteriophage P1 encoded HOT protein: a homologue of the theta subunit of E. coli DNA polymerase III ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1SE7 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'E. COLI BACTERIOPHAGE P1, HOMOLOGUE OF THETA, HOT, E. COLI DNA POLYMERASE III, Transferase' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 10 ? LEU A 32 ? SER A 10 LEU A 32 1 ? 23 HELX_P HELX_P2 2 ILE A 37 ? ARG A 43 ? ILE A 37 ARG A 43 1 ? 7 HELX_P HELX_P3 3 PRO A 46 ? ASN A 48 ? PRO A 46 ASN A 48 5 ? 3 HELX_P HELX_P4 4 LEU A 49 ? LEU A 67 ? LEU A 49 LEU A 67 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1SE7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1SE7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 TYR 2 2 2 TYR TYR A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 MET 54 54 54 MET MET A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 LYS 83 83 83 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-12-14 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 O A ALA 23 ? ? HH A TYR 60 ? ? 1.50 2 6 HH A TYR 52 ? ? HH21 A ARG 56 ? ? 1.26 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 2 ? ? 56.65 -163.78 2 1 TRP A 4 ? ? -148.86 -21.79 3 1 ASN A 5 ? ? -88.10 38.06 4 1 LEU A 32 ? ? -78.57 -86.70 5 1 ASN A 33 ? ? 178.24 20.20 6 1 LEU A 67 ? ? -44.29 170.02 7 1 PRO A 68 ? ? -58.84 -156.49 8 1 LYS A 69 ? ? -45.62 163.69 9 1 SER A 71 ? ? -178.60 79.97 10 1 ASP A 78 ? ? 58.99 8.38 11 1 ASP A 79 ? ? 59.07 18.28 12 1 ALA A 80 ? ? -94.73 -64.83 13 2 TYR A 2 ? ? 57.67 -170.71 14 2 TRP A 4 ? ? -160.12 -12.24 15 2 ASN A 5 ? ? -81.88 38.75 16 2 LYS A 9 ? ? -120.74 -50.70 17 2 LEU A 32 ? ? 73.36 -140.17 18 2 GLU A 44 ? ? -121.21 -69.71 19 2 ASN A 48 ? ? -58.01 -6.74 20 2 LEU A 67 ? ? -43.62 165.47 21 2 PRO A 68 ? ? -69.00 -100.62 22 2 SER A 71 ? ? -128.77 -145.56 23 2 ALA A 74 ? ? -90.53 37.35 24 2 ASP A 79 ? ? -143.39 -27.12 25 2 VAL A 81 ? ? 47.55 74.06 26 3 TRP A 4 ? ? -151.34 -7.79 27 3 ASN A 5 ? ? -90.47 33.63 28 3 ALA A 7 ? ? -94.52 30.56 29 3 SER A 10 ? ? -68.69 -162.66 30 3 GLN A 11 ? ? -100.84 -63.92 31 3 GLU A 30 ? ? -65.25 9.21 32 3 ARG A 31 ? ? -123.05 -61.69 33 3 LEU A 32 ? ? -103.03 -141.80 34 3 ASN A 33 ? ? -111.42 74.50 35 3 GLN A 45 ? ? 52.78 76.68 36 3 LEU A 67 ? ? -49.20 171.45 37 3 LYS A 69 ? ? 57.86 132.74 38 3 ASP A 79 ? ? -120.86 -72.53 39 3 ALA A 80 ? ? -172.49 76.43 40 4 TRP A 4 ? ? 173.61 151.90 41 4 GLU A 30 ? ? -66.36 7.37 42 4 ARG A 31 ? ? -122.18 -63.75 43 4 LEU A 32 ? ? -91.68 -132.08 44 4 GLU A 44 ? ? -120.98 -69.18 45 4 PRO A 68 ? ? -64.76 -165.55 46 4 LYS A 69 ? ? 56.60 -113.76 47 4 GLN A 76 ? ? -54.99 170.59 48 4 ASP A 79 ? ? -66.74 -70.02 49 4 ALA A 80 ? ? -172.72 -19.50 50 5 TRP A 4 ? ? -150.87 -19.87 51 5 ASN A 5 ? ? -87.92 41.25 52 5 GLU A 30 ? ? -68.80 9.16 53 5 ARG A 31 ? ? -121.15 -67.74 54 5 LEU A 32 ? ? -94.01 -128.96 55 5 PRO A 35 ? ? -68.01 81.56 56 5 GLU A 44 ? ? -121.03 -69.44 57 5 GLN A 45 ? ? 40.76 70.38 58 5 ASN A 48 ? ? -65.55 10.66 59 5 LEU A 67 ? ? -60.45 -167.93 60 5 PRO A 68 ? ? -68.62 -103.12 61 5 LYS A 69 ? ? 41.79 -154.34 62 5 SER A 71 ? ? -79.56 -159.59 63 5 ALA A 74 ? ? -64.99 11.92 64 5 ASP A 79 ? ? -157.84 75.33 65 6 TRP A 4 ? ? -165.60 0.76 66 6 LYS A 9 ? ? -96.89 -68.76 67 6 GLU A 30 ? ? -37.84 -31.73 68 6 LEU A 32 ? ? 76.94 -34.55 69 6 ASN A 33 ? ? 75.69 78.33 70 6 GLU A 44 ? ? -121.15 -69.47 71 6 GLN A 45 ? ? 33.57 75.53 72 6 ASN A 48 ? ? -71.58 23.88 73 6 LEU A 49 ? ? -158.28 4.24 74 6 PRO A 68 ? ? -85.56 -107.23 75 6 SER A 71 ? ? 62.60 175.91 76 6 ASP A 79 ? ? -142.53 -49.20 77 6 ALA A 80 ? ? -160.53 15.06 78 7 TRP A 4 ? ? -165.22 -30.53 79 7 ILE A 6 ? ? 58.31 1.33 80 7 ALA A 8 ? ? -153.03 87.91 81 7 LYS A 9 ? ? -107.50 -75.66 82 7 GLU A 30 ? ? -64.37 10.03 83 7 ARG A 31 ? ? -128.60 -58.84 84 7 LEU A 32 ? ? -104.90 -145.56 85 7 LEU A 67 ? ? -47.48 170.09 86 7 PRO A 68 ? ? -62.36 -163.44 87 7 LYS A 69 ? ? 62.49 -82.84 88 7 SER A 71 ? ? 56.98 -170.30 89 7 TYR A 75 ? ? 51.28 -174.42 #