data_1T0G # _entry.id 1T0G # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1T0G pdb_00001t0g 10.2210/pdb1t0g/pdb RCSB RCSB022157 ? ? WWPDB D_1000022157 ? ? BMRB 6138 ? 10.13018/BMR6138 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-04-13 2 'Structure model' 1 1 2008-02-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2020-02-05 5 'Structure model' 1 4 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_struct_ref_seq_dif.details' 4 5 'Structure model' '_database_2.pdbx_DOI' 5 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2004-04-13 _pdbx_database_PDB_obs_spr.pdb_id 1T0G _pdbx_database_PDB_obs_spr.replace_pdb_id 1SV7 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1T0G _pdbx_database_status.recvd_initial_deposition_date 2004-04-08 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type BMRB 6138 . unspecified TargetDB GO.6705 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Song, J.' 1 'Vinarov, D.A.' 2 'Tyler, E.M.' 3 'Shahan, M.N.' 4 'Tyler, R.C.' 5 'Markley, J.L.' 6 'Center for Eukaryotic Structural Genomics (CESG)' 7 # _citation.id primary _citation.title 'Hypothetical protein At2g24940.1 from Arabidopsis thaliana has a cytochrome b5 like fold' _citation.journal_abbrev J.Biomol.NMR _citation.journal_volume 30 _citation.page_first 215 _citation.page_last 218 _citation.year 2004 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15702529 _citation.pdbx_database_id_DOI 10.1023/B:JNMR.0000048943.34504.29 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Song, J.' 1 ? primary 'Vinarov, D.A.' 2 ? primary 'Tyler, E.M.' 3 ? primary 'Shahan, M.N.' 4 ? primary 'Tyler, R.C.' 5 ? primary 'Markley, J.L.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'cytochrome b5 domain-containing protein' _entity.formula_weight 12171.431 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHLEEFTAEQLSQYNGTDESKPIYVAIKGRVFDVTTGKSFYGSGGDYSMFAGKDASRALGKMSKNEEDVSPSLE GLTEKEINTLNDWETKFEAKYPVVGRVVS ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHLEEFTAEQLSQYNGTDESKPIYVAIKGRVFDVTTGKSFYGSGGDYSMFAGKDASRALGKMSKNEEDVSPSLE GLTEKEINTLNDWETKFEAKYPVVGRVVS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier GO.6705 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 LEU n 1 10 GLU n 1 11 GLU n 1 12 PHE n 1 13 THR n 1 14 ALA n 1 15 GLU n 1 16 GLN n 1 17 LEU n 1 18 SER n 1 19 GLN n 1 20 TYR n 1 21 ASN n 1 22 GLY n 1 23 THR n 1 24 ASP n 1 25 GLU n 1 26 SER n 1 27 LYS n 1 28 PRO n 1 29 ILE n 1 30 TYR n 1 31 VAL n 1 32 ALA n 1 33 ILE n 1 34 LYS n 1 35 GLY n 1 36 ARG n 1 37 VAL n 1 38 PHE n 1 39 ASP n 1 40 VAL n 1 41 THR n 1 42 THR n 1 43 GLY n 1 44 LYS n 1 45 SER n 1 46 PHE n 1 47 TYR n 1 48 GLY n 1 49 SER n 1 50 GLY n 1 51 GLY n 1 52 ASP n 1 53 TYR n 1 54 SER n 1 55 MET n 1 56 PHE n 1 57 ALA n 1 58 GLY n 1 59 LYS n 1 60 ASP n 1 61 ALA n 1 62 SER n 1 63 ARG n 1 64 ALA n 1 65 LEU n 1 66 GLY n 1 67 LYS n 1 68 MET n 1 69 SER n 1 70 LYS n 1 71 ASN n 1 72 GLU n 1 73 GLU n 1 74 ASP n 1 75 VAL n 1 76 SER n 1 77 PRO n 1 78 SER n 1 79 LEU n 1 80 GLU n 1 81 GLY n 1 82 LEU n 1 83 THR n 1 84 GLU n 1 85 LYS n 1 86 GLU n 1 87 ILE n 1 88 ASN n 1 89 THR n 1 90 LEU n 1 91 ASN n 1 92 ASP n 1 93 TRP n 1 94 GLU n 1 95 THR n 1 96 LYS n 1 97 PHE n 1 98 GLU n 1 99 ALA n 1 100 LYS n 1 101 TYR n 1 102 PRO n 1 103 VAL n 1 104 VAL n 1 105 GLY n 1 106 ARG n 1 107 VAL n 1 108 VAL n 1 109 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'thale cress' _entity_src_gen.gene_src_genus Arabidopsis _entity_src_gen.pdbx_gene_src_gene At2g24940.1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'CELL-FREE SYNTHESIS' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PEU(N)HIS6' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'WHEAT GERM CELL-FREE, IN VITRO EXPRESSION' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 MET 55 55 55 MET MET A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 TRP 93 93 93 TRP TRP A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 SER 109 109 109 SER SER A . n # _exptl.entry_id 1T0G _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.density_Matthews ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1T0G _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1T0G _struct.title 'Hypothetical protein At2g24940.1 from Arabidopsis thaliana has a cytochrome b5 like fold' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1T0G _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;structural genomics, hypothetical protein, At2g24940.1, PSI, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SBP3_ARATH _struct_ref.pdbx_db_accession Q9SK39 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEFTAEQLSQYNGTDESKPIYVAIKGRVFDVTTGKSFYGSGGDYSMFAGKDASRALGKMSKNEEDVSPSLEGLTEKEINT LNDWETKFEAKYPVVGRVVS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1T0G _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 10 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 109 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9SK39 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 100 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 10 _struct_ref_seq.pdbx_auth_seq_align_end 109 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1T0G GLY A 2 ? UNP Q9SK39 ? ? 'cloning artifact' 2 1 1 1T0G HIS A 3 ? UNP Q9SK39 ? ? 'expression tag' 3 2 1 1T0G HIS A 4 ? UNP Q9SK39 ? ? 'expression tag' 4 3 1 1T0G HIS A 5 ? UNP Q9SK39 ? ? 'expression tag' 5 4 1 1T0G HIS A 6 ? UNP Q9SK39 ? ? 'expression tag' 6 5 1 1T0G HIS A 7 ? UNP Q9SK39 ? ? 'expression tag' 7 6 1 1T0G HIS A 8 ? UNP Q9SK39 ? ? 'expression tag' 8 7 1 1T0G LEU A 9 ? UNP Q9SK39 ? ? 'cloning artifact' 9 8 1 1T0G GLU A 10 ? UNP Q9SK39 ? ? 'cloning artifact' 10 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 14 ? SER A 18 ? ALA A 14 SER A 18 1 ? 5 HELX_P HELX_P2 2 THR A 41 ? LYS A 44 ? THR A 41 LYS A 44 5 ? 4 HELX_P HELX_P3 3 ALA A 61 ? MET A 68 ? ALA A 61 MET A 68 1 ? 8 HELX_P HELX_P4 4 THR A 83 ? ALA A 99 ? THR A 83 ALA A 99 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 10 ? THR A 13 ? GLU A 10 THR A 13 A 2 VAL A 103 ? VAL A 108 ? VAL A 103 VAL A 108 A 3 ARG A 36 ? ASP A 39 ? ARG A 36 ASP A 39 A 4 TYR A 30 ? ILE A 33 ? TYR A 30 ILE A 33 A 5 LYS A 59 ? ASP A 60 ? LYS A 59 ASP A 60 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N PHE A 12 ? N PHE A 12 O VAL A 108 ? O VAL A 108 A 2 3 O GLY A 105 ? O GLY A 105 N VAL A 37 ? N VAL A 37 A 3 4 O PHE A 38 ? O PHE A 38 N VAL A 31 ? N VAL A 31 A 4 5 N ALA A 32 ? N ALA A 32 O LYS A 59 ? O LYS A 59 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASP 60 ? ? HG A SER 62 ? ? 1.59 2 3 HG1 A THR 83 ? ? OE1 A GLU 86 ? ? 1.56 3 3 OD1 A ASP 60 ? ? HG A SER 62 ? ? 1.57 4 4 OD2 A ASP 52 ? ? HZ3 A LYS 70 ? ? 1.60 5 5 OD1 A ASP 60 ? ? HG A SER 62 ? ? 1.57 6 6 OD1 A ASP 39 ? ? HG1 A THR 41 ? ? 1.55 7 6 OD2 A ASP 52 ? ? HZ3 A LYS 70 ? ? 1.60 8 6 OD1 A ASP 60 ? ? HG A SER 62 ? ? 1.60 9 8 OD1 A ASP 60 ? ? HG A SER 62 ? ? 1.56 10 8 HD1 A HIS 5 ? ? OE1 A GLU 10 ? ? 1.60 11 9 OD1 A ASP 60 ? ? HG A SER 62 ? ? 1.57 12 11 OD1 A ASP 60 ? ? HG A SER 62 ? ? 1.56 13 12 OD1 A ASP 60 ? ? HG A SER 62 ? ? 1.57 14 12 OD2 A ASP 52 ? ? HZ3 A LYS 70 ? ? 1.58 15 12 HD1 A HIS 6 ? ? OE1 A GLU 10 ? ? 1.60 16 13 OD1 A ASP 60 ? ? HG A SER 62 ? ? 1.58 17 15 HZ1 A LYS 67 ? ? OE1 A GLU 86 ? ? 1.58 18 15 OD1 A ASP 60 ? ? HG A SER 62 ? ? 1.60 19 17 HZ1 A LYS 67 ? ? OE1 A GLU 86 ? ? 1.59 20 19 HE2 A HIS 5 ? ? OE2 A GLU 10 ? ? 1.59 21 20 HZ1 A LYS 67 ? ? OE2 A GLU 86 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 4 ? ? -68.66 97.00 2 1 HIS A 5 ? ? -150.61 70.69 3 1 HIS A 8 ? ? -155.62 -44.48 4 1 LEU A 9 ? ? -125.99 -169.25 5 1 TYR A 20 ? ? -91.23 33.48 6 1 SER A 26 ? ? 64.04 71.95 7 1 TYR A 47 ? ? -96.68 -66.75 8 1 SER A 49 ? ? -150.40 20.59 9 1 PRO A 77 ? ? -77.12 20.71 10 2 HIS A 3 ? ? 62.79 82.48 11 2 HIS A 8 ? ? -173.56 -78.71 12 2 LEU A 9 ? ? 165.48 155.72 13 2 SER A 18 ? ? -60.66 2.48 14 2 SER A 26 ? ? 81.53 15.71 15 2 TYR A 47 ? ? -93.09 -69.29 16 2 SER A 49 ? ? -142.66 10.09 17 2 ALA A 57 ? ? -41.67 -16.09 18 2 MET A 68 ? ? 72.51 62.55 19 2 GLU A 80 ? ? 53.91 95.73 20 2 LYS A 100 ? ? -126.02 -55.58 21 3 HIS A 8 ? ? 64.21 -74.45 22 3 SER A 26 ? ? 76.00 80.12 23 3 MET A 68 ? ? 67.64 60.94 24 3 THR A 83 ? ? -105.42 -169.60 25 4 HIS A 7 ? ? -126.45 -86.09 26 4 TYR A 20 ? ? -98.85 31.18 27 4 TYR A 47 ? ? -92.34 -74.56 28 4 SER A 49 ? ? -172.13 -29.23 29 4 GLU A 80 ? ? 43.97 -93.29 30 4 LYS A 100 ? ? -139.28 -66.60 31 5 HIS A 6 ? ? -108.63 -169.02 32 5 HIS A 7 ? ? -117.64 68.18 33 5 HIS A 8 ? ? 176.66 -49.52 34 5 TYR A 20 ? ? -107.87 80.00 35 5 SER A 26 ? ? 62.61 65.02 36 5 TYR A 47 ? ? -102.69 -64.44 37 6 HIS A 3 ? ? 60.80 -156.81 38 6 HIS A 4 ? ? 76.84 -67.05 39 6 SER A 18 ? ? -69.15 9.13 40 6 TYR A 47 ? ? -93.75 -63.58 41 6 ALA A 61 ? ? -97.87 31.78 42 6 MET A 68 ? ? 70.99 -52.25 43 6 SER A 69 ? ? 43.03 -86.73 44 6 SER A 76 ? ? -174.69 148.31 45 7 HIS A 6 ? ? -170.59 -168.48 46 7 HIS A 8 ? ? 164.60 108.26 47 7 LEU A 9 ? ? 68.45 113.25 48 7 SER A 18 ? ? -68.05 8.19 49 7 TYR A 20 ? ? -92.40 39.13 50 7 GLU A 25 ? ? 68.27 -69.32 51 7 SER A 26 ? ? -169.51 20.24 52 7 ASP A 60 ? ? -57.18 99.51 53 7 LEU A 79 ? ? -112.44 79.85 54 7 VAL A 104 ? ? -117.27 69.31 55 8 HIS A 3 ? ? -152.84 24.54 56 8 HIS A 4 ? ? 67.96 117.82 57 8 HIS A 7 ? ? 68.54 -0.76 58 8 TYR A 20 ? ? -89.79 37.39 59 8 GLU A 25 ? ? 59.00 13.29 60 8 TYR A 47 ? ? -90.66 -76.53 61 8 SER A 49 ? ? -144.81 17.32 62 8 GLU A 80 ? ? 61.48 -87.32 63 8 LYS A 100 ? ? -131.02 -43.74 64 9 HIS A 3 ? ? -98.22 -78.99 65 9 HIS A 8 ? ? 64.38 -159.25 66 9 SER A 18 ? ? -62.78 17.26 67 9 TYR A 20 ? ? -95.36 40.37 68 9 SER A 26 ? ? 77.54 68.98 69 9 PRO A 77 ? ? -70.38 44.77 70 9 GLU A 80 ? ? 59.20 -92.71 71 9 LYS A 100 ? ? -130.71 -42.86 72 10 HIS A 7 ? ? -160.63 82.98 73 10 HIS A 8 ? ? -140.85 -63.92 74 10 SER A 26 ? ? 74.61 -87.84 75 10 LYS A 27 ? ? 57.43 -173.92 76 10 PRO A 77 ? ? -77.20 33.72 77 11 HIS A 4 ? ? -141.79 -26.50 78 11 HIS A 5 ? ? 49.03 -169.71 79 11 HIS A 8 ? ? 76.42 -64.29 80 11 SER A 18 ? ? -71.16 20.10 81 11 GLU A 25 ? ? 58.13 19.67 82 11 MET A 68 ? ? 82.38 14.19 83 11 SER A 76 ? ? 178.10 148.87 84 11 GLU A 80 ? ? 59.18 -98.46 85 12 HIS A 3 ? ? 70.26 -66.46 86 12 HIS A 8 ? ? 160.83 -33.44 87 12 LEU A 9 ? ? 73.95 140.71 88 12 GLU A 25 ? ? 57.08 19.77 89 12 MET A 68 ? ? 72.19 68.86 90 12 LYS A 70 ? ? -159.95 -18.15 91 13 HIS A 4 ? ? 72.00 94.54 92 13 HIS A 8 ? ? 72.96 -70.01 93 13 GLU A 25 ? ? -106.53 69.35 94 13 SER A 26 ? ? 84.64 83.51 95 13 TYR A 47 ? ? -96.91 -68.88 96 14 HIS A 4 ? ? 62.03 101.39 97 14 HIS A 6 ? ? -162.30 95.55 98 14 HIS A 8 ? ? 73.61 -52.45 99 14 SER A 26 ? ? 56.92 70.17 100 14 TYR A 47 ? ? -86.83 -79.80 101 14 PHE A 56 ? ? -110.76 68.17 102 14 LYS A 70 ? ? -155.76 2.13 103 15 HIS A 6 ? ? 66.49 60.63 104 15 SER A 18 ? ? -64.45 8.50 105 15 ASP A 24 ? ? -67.96 97.26 106 15 TYR A 47 ? ? -101.34 -70.05 107 16 HIS A 3 ? ? 69.82 -177.24 108 16 HIS A 4 ? ? 73.51 -1.08 109 16 SER A 18 ? ? -65.96 2.52 110 16 TYR A 20 ? ? -95.68 38.83 111 16 LYS A 70 ? ? -151.54 20.92 112 16 PRO A 77 ? ? -85.35 32.46 113 17 ASN A 21 ? ? -59.54 -0.86 114 17 GLU A 25 ? ? -118.97 79.24 115 17 SER A 26 ? ? 91.39 79.89 116 17 LYS A 34 ? ? 74.31 -57.77 117 17 SER A 49 ? ? -173.72 -28.52 118 17 MET A 68 ? ? 82.24 20.99 119 17 SER A 76 ? ? -177.06 146.41 120 17 GLU A 80 ? ? 57.23 -90.69 121 18 HIS A 8 ? ? -166.11 -65.52 122 18 SER A 18 ? ? -67.91 6.61 123 18 LYS A 34 ? ? 71.70 -73.78 124 18 TYR A 47 ? ? -94.20 -71.17 125 18 ASP A 60 ? ? -59.01 107.10 126 18 LEU A 79 ? ? -152.12 81.11 127 18 GLU A 80 ? ? -141.18 -61.17 128 18 LYS A 100 ? ? -132.72 -44.42 129 19 HIS A 4 ? ? -152.65 63.33 130 19 HIS A 5 ? ? -150.97 81.76 131 19 HIS A 7 ? ? -173.91 148.43 132 19 HIS A 8 ? ? 75.29 152.79 133 19 TYR A 20 ? ? -96.50 37.08 134 19 GLU A 25 ? ? 58.24 14.90 135 19 PRO A 28 ? ? -26.83 118.55 136 19 TYR A 47 ? ? -90.41 -63.81 137 19 MET A 68 ? ? 80.83 18.78 138 19 GLU A 80 ? ? 57.83 -51.68 139 20 HIS A 8 ? ? 172.25 -50.12 140 20 LEU A 9 ? ? -177.74 147.52 141 20 GLU A 25 ? ? 69.76 -64.78 142 20 SER A 26 ? ? -179.15 22.03 143 20 TYR A 47 ? ? -95.36 -65.38 144 20 SER A 49 ? ? -159.74 21.44 145 20 MET A 68 ? ? 70.79 33.57 146 20 PRO A 77 ? ? -80.01 31.68 147 20 GLU A 80 ? ? 63.95 -86.15 148 20 LYS A 100 ? ? -120.73 -50.77 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Center for Eukaryotic Structural Genomics' _pdbx_SG_project.initial_of_center CESG # _pdbx_nmr_ensemble.entry_id 1T0G _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'back calculated data agree with experimental NOESY spectrum,target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1T0G _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.5 mM At2g24940.1; 50mM KCl; 10 mM KH2PO4; 0.02% (w/v) sodium azide; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_details.entry_id 1T0G _pdbx_nmr_details.text 'This structure was determined using standard 3D heteronuclear NMR techniques' # _pdbx_nmr_refine.entry_id 1T0G _pdbx_nmr_refine.method 'molecular dynamics, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 3.2 collection Bruker 1 NMRPipe 2.1 processing 'Delaglio et al' 2 Sparky 3.72 'data analysis' 'Goddard and Kneller' 3 CYANA 1.0.5 'structure solution' 'Gunter et al' 4 XPLOR-NIH 2.9.3 refinement 'Brunger et al; Schwieters et al' 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.field_strength 500 # _atom_sites.entry_id 1T0G _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_