data_1TBX # _entry.id 1TBX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1TBX RCSB RCSB022535 WWPDB D_1000022535 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1TBX _pdbx_database_status.recvd_initial_deposition_date 2004-05-20 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kraft, P.' 1 'Oeckinghaus, A.' 2 'Kummel, D.' 3 'Gauss, G.H.' 4 'Wiedenheft, B.' 5 'Young, M.' 6 'Lawrence, C.M.' 7 # _citation.id primary _citation.title 'Crystal structure of F-93 from Sulfolobus spindle-shaped virus 1, a winged-helix DNA binding protein.' _citation.journal_abbrev J.Virol. _citation.journal_volume 78 _citation.page_first 11544 _citation.page_last 11550 _citation.year 2004 _citation.journal_id_ASTM JOVIAM _citation.country US _citation.journal_id_ISSN 0022-538X _citation.journal_id_CSD 0825 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15479795 _citation.pdbx_database_id_DOI 10.1128/JVI.78.21.11544-11550.2004 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kraft, P.' 1 primary 'Oeckinghaus, A.' 2 primary 'Kummel, D.' 3 primary 'Gauss, G.H.' 4 primary 'Gilmore, J.' 5 primary 'Wiedenheft, B.' 6 primary 'Young, M.' 7 primary 'Lawrence, C.M.' 8 # _cell.entry_id 1TBX _cell.length_a 120.493 _cell.length_b 120.493 _cell.length_c 120.493 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 48 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1TBX _symmetry.space_group_name_H-M 'P 43 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 212 _symmetry.space_group_name_Hall ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hypothetical 11.0 kDa protein' _entity.formula_weight 11905.413 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ORF F-93' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)KSTPFFYPEAIVLAYLYDNEGIATYDLYKKVNAEFP(MSE)STATFYDAKKFLIQEGFVKERQERGEKRLYLTEK GKLFAISLKTAIETYKQIKKRHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MKSTPFFYPEAIVLAYLYDNEGIATYDLYKKVNAEFPMSTATFYDAKKFLIQEGFVKERQERGEKRLYLTEKGKLFAISL KTAIETYKQIKKRHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 LYS n 1 3 SER n 1 4 THR n 1 5 PRO n 1 6 PHE n 1 7 PHE n 1 8 TYR n 1 9 PRO n 1 10 GLU n 1 11 ALA n 1 12 ILE n 1 13 VAL n 1 14 LEU n 1 15 ALA n 1 16 TYR n 1 17 LEU n 1 18 TYR n 1 19 ASP n 1 20 ASN n 1 21 GLU n 1 22 GLY n 1 23 ILE n 1 24 ALA n 1 25 THR n 1 26 TYR n 1 27 ASP n 1 28 LEU n 1 29 TYR n 1 30 LYS n 1 31 LYS n 1 32 VAL n 1 33 ASN n 1 34 ALA n 1 35 GLU n 1 36 PHE n 1 37 PRO n 1 38 MSE n 1 39 SER n 1 40 THR n 1 41 ALA n 1 42 THR n 1 43 PHE n 1 44 TYR n 1 45 ASP n 1 46 ALA n 1 47 LYS n 1 48 LYS n 1 49 PHE n 1 50 LEU n 1 51 ILE n 1 52 GLN n 1 53 GLU n 1 54 GLY n 1 55 PHE n 1 56 VAL n 1 57 LYS n 1 58 GLU n 1 59 ARG n 1 60 GLN n 1 61 GLU n 1 62 ARG n 1 63 GLY n 1 64 GLU n 1 65 LYS n 1 66 ARG n 1 67 LEU n 1 68 TYR n 1 69 LEU n 1 70 THR n 1 71 GLU n 1 72 LYS n 1 73 GLY n 1 74 LYS n 1 75 LEU n 1 76 PHE n 1 77 ALA n 1 78 ILE n 1 79 SER n 1 80 LEU n 1 81 LYS n 1 82 THR n 1 83 ALA n 1 84 ILE n 1 85 GLU n 1 86 THR n 1 87 TYR n 1 88 LYS n 1 89 GLN n 1 90 ILE n 1 91 LYS n 1 92 LYS n 1 93 ARG n 1 94 HIS n 1 95 HIS n 1 96 HIS n 1 97 HIS n 1 98 HIS n 1 99 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Fusellovirus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sulfolobus virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 244589 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y110_SSV1 _struct_ref.pdbx_db_accession P20222 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKSTPFFYPEAIVLAYLYDNEGIATYDLYKKVNAEFPMSTATFYDAKKFLIQEGFVKERQERGEKRLYLTEKGKLFAISL KTAIETYKQIKKR ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1TBX A 1 ? 93 ? P20222 1 ? 93 ? 1 93 2 1 1TBX B 1 ? 93 ? P20222 1 ? 93 ? 1 93 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1TBX HIS A 94 ? UNP P20222 ? ? 'EXPRESSION TAG' 94 1 1 1TBX HIS A 95 ? UNP P20222 ? ? 'EXPRESSION TAG' 95 2 1 1TBX HIS A 96 ? UNP P20222 ? ? 'EXPRESSION TAG' 96 3 1 1TBX HIS A 97 ? UNP P20222 ? ? 'EXPRESSION TAG' 97 4 1 1TBX HIS A 98 ? UNP P20222 ? ? 'EXPRESSION TAG' 98 5 1 1TBX HIS A 99 ? UNP P20222 ? ? 'EXPRESSION TAG' 99 6 2 1TBX HIS B 94 ? UNP P20222 ? ? 'EXPRESSION TAG' 94 7 2 1TBX HIS B 95 ? UNP P20222 ? ? 'EXPRESSION TAG' 95 8 2 1TBX HIS B 96 ? UNP P20222 ? ? 'EXPRESSION TAG' 96 9 2 1TBX HIS B 97 ? UNP P20222 ? ? 'EXPRESSION TAG' 97 10 2 1TBX HIS B 98 ? UNP P20222 ? ? 'EXPRESSION TAG' 98 11 2 1TBX HIS B 99 ? UNP P20222 ? ? 'EXPRESSION TAG' 99 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1TBX _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.06 _exptl_crystal.density_percent_sol 59.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.6 _exptl_crystal_grow.pdbx_details '3.25 M NaCl, 120 mM HEPES, pH 7.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9790 1.0 2 0.9787 1.0 3 0.9562 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 14-BM-D' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 14-BM-D _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.9790, 0.9787, 0.9562' # _reflns.entry_id 1TBX _reflns.observed_criterion_sigma_F 0.0 _reflns.observed_criterion_sigma_I ? _reflns.d_resolution_high 2.7 _reflns.d_resolution_low 20 _reflns.number_all ? _reflns.number_obs 7936 _reflns.percent_possible_obs 98.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.05 _reflns.pdbx_netI_over_sigmaI 41 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 9.24 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low 2.81 _reflns_shell.percent_possible_all 98.9 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.167 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1TBX _refine.ls_number_reflns_obs 7936 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 14.00 _refine.ls_d_res_high 2.70 _refine.ls_percent_reflns_obs 97.17 _refine.ls_R_factor_obs 0.19448 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1914 _refine.ls_R_factor_R_free 0.25945 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 401 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.956 _refine.correlation_coeff_Fo_to_Fc_free 0.907 _refine.B_iso_mean 29.457 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.00 _refine.pdbx_solvent_ion_probe_radii 1.00 _refine.pdbx_solvent_shrinkage_radii 1.00 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.491 _refine.pdbx_overall_ESU_R_Free 0.317 _refine.overall_SU_ML 0.263 _refine.overall_SU_B 13.643 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1TBX _refine_analyze.Luzzati_coordinate_error_obs 0.491 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs 2.7 _refine_analyze.Luzzati_coordinate_error_free 0.317 _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1535 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1535 _refine_hist.d_res_high 2.70 _refine_hist.d_res_low 14.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.019 0.022 ? 1572 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.924 1.965 ? 2111 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 9.202 5.000 ? 182 'X-RAY DIFFRACTION' ? r_chiral_restr 0.119 0.200 ? 224 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.020 ? 1167 'X-RAY DIFFRACTION' ? r_nbd_refined 0.255 0.200 ? 779 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.157 0.200 ? 40 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.327 0.200 ? 33 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.149 0.200 ? 4 'X-RAY DIFFRACTION' ? r_mcbond_it 2.983 5.000 ? 916 'X-RAY DIFFRACTION' ? r_mcangle_it 4.602 6.000 ? 1476 'X-RAY DIFFRACTION' ? r_scbond_it 4.819 6.000 ? 656 'X-RAY DIFFRACTION' ? r_scangle_it 6.642 7.500 ? 635 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ens_id _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.weight_B_iso 1 'tight positional' A 216 0.08 0.05 1 'X-RAY DIFFRACTION' 1 ? ? ? 1 'medium positional' A 229 0.57 0.50 1 'X-RAY DIFFRACTION' 2 ? ? ? 1 'tight thermal' A 216 0.22 0.50 1 'X-RAY DIFFRACTION' 3 ? ? ? 1 'medium thermal' A 229 1.79 2.00 1 'X-RAY DIFFRACTION' 4 ? ? ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.70 _refine_ls_shell.d_res_low 2.771 _refine_ls_shell.number_reflns_R_work 557 _refine_ls_shell.R_factor_R_work 0.277 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.282 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 23 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 A 1 2 B 1 3 A 1 4 B 1 5 A 1 6 B 1 7 A 1 8 B # loop_ _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.selection_details 1 1 2 A 11 A 19 A ALA 11 . A ASP 19 . 1 ? 2 1 2 B 11 B 19 B ALA 11 . B ASP 19 . 1 ? 3 2 2 A 24 A 33 A ALA 24 . A ASN 33 . 1 ? 4 2 2 B 24 B 33 B ALA 24 . B ASN 33 . 1 ? 5 3 2 A 40 A 53 A THR 40 . A GLU 53 . 1 ? 6 3 2 B 40 B 53 B THR 40 . B GLU 53 . 1 ? 7 4 2 A 71 A 91 A GLU 71 . A LYS 91 . 1 ? 8 4 2 B 71 B 91 B GLU 71 . B LYS 91 . 1 ? # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 1TBX _struct.title 'Crystal structure of SSV1 F-93' _struct.pdbx_descriptor 'Hypothetical 11.0 kDa protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1TBX _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'Sulfolobus Spindle Virus, Winged Helix, F-93, fusellovirus, Viral protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 _struct_biol.details 'The biological assembly is thought to correspond to the dimer of the asymmetric unit.' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 8 ? TYR A 18 ? TYR A 8 TYR A 18 1 ? 11 HELX_P HELX_P2 2 ALA A 24 ? ALA A 34 ? ALA A 24 ALA A 34 1 ? 11 HELX_P HELX_P3 3 SER A 39 ? GLU A 53 ? SER A 39 GLU A 53 1 ? 15 HELX_P HELX_P4 4 THR A 70 ? HIS A 95 ? THR A 70 HIS A 95 1 ? 26 HELX_P HELX_P5 5 TYR B 8 ? TYR B 18 ? TYR B 8 TYR B 18 1 ? 11 HELX_P HELX_P6 6 ALA B 24 ? PHE B 36 ? ALA B 24 PHE B 36 1 ? 13 HELX_P HELX_P7 7 SER B 39 ? GLU B 53 ? SER B 39 GLU B 53 1 ? 15 HELX_P HELX_P8 8 THR B 70 ? LYS B 91 ? THR B 70 LYS B 91 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A PRO 37 C ? ? ? 1_555 A MSE 38 N ? ? A PRO 37 A MSE 38 1_555 ? ? ? ? ? ? ? 1.322 ? covale2 covale ? ? A MSE 38 C ? ? ? 1_555 A SER 39 N ? ? A MSE 38 A SER 39 1_555 ? ? ? ? ? ? ? 1.325 ? covale3 covale ? ? B PRO 37 C ? ? ? 1_555 B MSE 38 N ? ? B PRO 37 B MSE 38 1_555 ? ? ? ? ? ? ? 1.330 ? covale4 covale ? ? B MSE 38 C ? ? ? 1_555 B SER 39 N ? ? B MSE 38 B SER 39 1_555 ? ? ? ? ? ? ? 1.324 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 56 ? GLU A 61 ? VAL A 56 GLU A 61 A 2 GLU A 64 ? LEU A 69 ? GLU A 64 LEU A 69 B 1 VAL B 56 ? GLN B 60 ? VAL B 56 GLN B 60 B 2 LYS B 65 ? LEU B 69 ? LYS B 65 LEU B 69 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 59 ? N ARG A 59 O ARG A 66 ? O ARG A 66 B 1 2 N ARG B 59 ? N ARG B 59 O ARG B 66 ? O ARG B 66 # _database_PDB_matrix.entry_id 1TBX _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1TBX _atom_sites.fract_transf_matrix[1][1] 0.008299 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008299 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008299 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 LYS 2 2 ? ? ? A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 MSE 38 38 38 MSE MSE A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 HIS 97 97 ? ? ? A . n A 1 98 HIS 98 98 ? ? ? A . n A 1 99 HIS 99 99 ? ? ? A . n B 1 1 MSE 1 1 ? ? ? B . n B 1 2 LYS 2 2 2 LYS LYS B . n B 1 3 SER 3 3 3 SER SER B . n B 1 4 THR 4 4 4 THR THR B . n B 1 5 PRO 5 5 5 PRO PRO B . n B 1 6 PHE 6 6 6 PHE PHE B . n B 1 7 PHE 7 7 7 PHE PHE B . n B 1 8 TYR 8 8 8 TYR TYR B . n B 1 9 PRO 9 9 9 PRO PRO B . n B 1 10 GLU 10 10 10 GLU GLU B . n B 1 11 ALA 11 11 11 ALA ALA B . n B 1 12 ILE 12 12 12 ILE ILE B . n B 1 13 VAL 13 13 13 VAL VAL B . n B 1 14 LEU 14 14 14 LEU LEU B . n B 1 15 ALA 15 15 15 ALA ALA B . n B 1 16 TYR 16 16 16 TYR TYR B . n B 1 17 LEU 17 17 17 LEU LEU B . n B 1 18 TYR 18 18 18 TYR TYR B . n B 1 19 ASP 19 19 19 ASP ASP B . n B 1 20 ASN 20 20 20 ASN ASN B . n B 1 21 GLU 21 21 21 GLU GLU B . n B 1 22 GLY 22 22 22 GLY GLY B . n B 1 23 ILE 23 23 23 ILE ILE B . n B 1 24 ALA 24 24 24 ALA ALA B . n B 1 25 THR 25 25 25 THR THR B . n B 1 26 TYR 26 26 26 TYR TYR B . n B 1 27 ASP 27 27 27 ASP ASP B . n B 1 28 LEU 28 28 28 LEU LEU B . n B 1 29 TYR 29 29 29 TYR TYR B . n B 1 30 LYS 30 30 30 LYS LYS B . n B 1 31 LYS 31 31 31 LYS LYS B . n B 1 32 VAL 32 32 32 VAL VAL B . n B 1 33 ASN 33 33 33 ASN ASN B . n B 1 34 ALA 34 34 34 ALA ALA B . n B 1 35 GLU 35 35 35 GLU GLU B . n B 1 36 PHE 36 36 36 PHE PHE B . n B 1 37 PRO 37 37 37 PRO PRO B . n B 1 38 MSE 38 38 38 MSE MSE B . n B 1 39 SER 39 39 39 SER SER B . n B 1 40 THR 40 40 40 THR THR B . n B 1 41 ALA 41 41 41 ALA ALA B . n B 1 42 THR 42 42 42 THR THR B . n B 1 43 PHE 43 43 43 PHE PHE B . n B 1 44 TYR 44 44 44 TYR TYR B . n B 1 45 ASP 45 45 45 ASP ASP B . n B 1 46 ALA 46 46 46 ALA ALA B . n B 1 47 LYS 47 47 47 LYS LYS B . n B 1 48 LYS 48 48 48 LYS LYS B . n B 1 49 PHE 49 49 49 PHE PHE B . n B 1 50 LEU 50 50 50 LEU LEU B . n B 1 51 ILE 51 51 51 ILE ILE B . n B 1 52 GLN 52 52 52 GLN GLN B . n B 1 53 GLU 53 53 53 GLU GLU B . n B 1 54 GLY 54 54 54 GLY GLY B . n B 1 55 PHE 55 55 55 PHE PHE B . n B 1 56 VAL 56 56 56 VAL VAL B . n B 1 57 LYS 57 57 57 LYS LYS B . n B 1 58 GLU 58 58 58 GLU GLU B . n B 1 59 ARG 59 59 59 ARG ARG B . n B 1 60 GLN 60 60 60 GLN GLN B . n B 1 61 GLU 61 61 61 GLU GLU B . n B 1 62 ARG 62 62 62 ARG ARG B . n B 1 63 GLY 63 63 63 GLY GLY B . n B 1 64 GLU 64 64 64 GLU GLU B . n B 1 65 LYS 65 65 65 LYS LYS B . n B 1 66 ARG 66 66 66 ARG ARG B . n B 1 67 LEU 67 67 67 LEU LEU B . n B 1 68 TYR 68 68 68 TYR TYR B . n B 1 69 LEU 69 69 69 LEU LEU B . n B 1 70 THR 70 70 70 THR THR B . n B 1 71 GLU 71 71 71 GLU GLU B . n B 1 72 LYS 72 72 72 LYS LYS B . n B 1 73 GLY 73 73 73 GLY GLY B . n B 1 74 LYS 74 74 74 LYS LYS B . n B 1 75 LEU 75 75 75 LEU LEU B . n B 1 76 PHE 76 76 76 PHE PHE B . n B 1 77 ALA 77 77 77 ALA ALA B . n B 1 78 ILE 78 78 78 ILE ILE B . n B 1 79 SER 79 79 79 SER SER B . n B 1 80 LEU 80 80 80 LEU LEU B . n B 1 81 LYS 81 81 81 LYS LYS B . n B 1 82 THR 82 82 82 THR THR B . n B 1 83 ALA 83 83 83 ALA ALA B . n B 1 84 ILE 84 84 84 ILE ILE B . n B 1 85 GLU 85 85 85 GLU GLU B . n B 1 86 THR 86 86 86 THR THR B . n B 1 87 TYR 87 87 87 TYR TYR B . n B 1 88 LYS 88 88 88 LYS LYS B . n B 1 89 GLN 89 89 89 GLN GLN B . n B 1 90 ILE 90 90 90 ILE ILE B . n B 1 91 LYS 91 91 91 LYS LYS B . n B 1 92 LYS 92 92 ? ? ? B . n B 1 93 ARG 93 93 ? ? ? B . n B 1 94 HIS 94 94 ? ? ? B . n B 1 95 HIS 95 95 ? ? ? B . n B 1 96 HIS 96 96 ? ? ? B . n B 1 97 HIS 97 97 ? ? ? B . n B 1 98 HIS 98 98 ? ? ? B . n B 1 99 HIS 99 99 ? ? ? B . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 38 A MSE 38 ? MET SELENOMETHIONINE 2 B MSE 38 B MSE 38 ? MET SELENOMETHIONINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 software_defined_assembly PISA tetrameric 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 2 1,2 A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2010 ? 1 MORE -19 ? 1 'SSA (A^2)' 9930 ? 2 'ABSA (A^2)' 6270 ? 2 MORE -49 ? 2 'SSA (A^2)' 17620 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 13_545 y+1/4,x-1/4,-z+3/4 0.0000000000 1.0000000000 0.0000000000 30.1232500000 1.0000000000 0.0000000000 0.0000000000 -30.1232500000 0.0000000000 0.0000000000 -1.0000000000 90.3697500000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-07-13 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Refinement description' 4 3 'Structure model' 'Version format compliance' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 79.7916 _pdbx_refine_tls.origin_y 60.6764 _pdbx_refine_tls.origin_z 35.9355 _pdbx_refine_tls.T[1][1] 0.4123 _pdbx_refine_tls.T[2][2] 0.4392 _pdbx_refine_tls.T[3][3] 0.0663 _pdbx_refine_tls.T[1][2] 0.1230 _pdbx_refine_tls.T[1][3] 0.0218 _pdbx_refine_tls.T[2][3] 0.1351 _pdbx_refine_tls.L[1][1] 6.6315 _pdbx_refine_tls.L[2][2] 3.5343 _pdbx_refine_tls.L[3][3] 6.4668 _pdbx_refine_tls.L[1][2] -1.4750 _pdbx_refine_tls.L[1][3] -4.2961 _pdbx_refine_tls.L[2][3] -0.5633 _pdbx_refine_tls.S[1][1] -0.1009 _pdbx_refine_tls.S[2][2] 0.1233 _pdbx_refine_tls.S[3][3] -0.0225 _pdbx_refine_tls.S[1][2] 0.1736 _pdbx_refine_tls.S[1][3] -0.0181 _pdbx_refine_tls.S[2][3] 0.1963 _pdbx_refine_tls.S[2][1] 0.5072 _pdbx_refine_tls.S[3][1] -0.7312 _pdbx_refine_tls.S[3][2] -0.4417 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 B 2 B 91 ? . . . . ? 'X-RAY DIFFRACTION' 2 1 A 3 A 96 ? . . . . ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.1.24 ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 SOLVE phasing . ? 4 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 PHE _pdbx_validate_rmsd_angle.auth_seq_id_1 6 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PHE _pdbx_validate_rmsd_angle.auth_seq_id_2 6 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PHE _pdbx_validate_rmsd_angle.auth_seq_id_3 6 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 89.69 _pdbx_validate_rmsd_angle.angle_target_value 111.00 _pdbx_validate_rmsd_angle.angle_deviation -21.31 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.70 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 4 ? ? 58.30 112.07 2 1 PHE A 6 ? ? -171.50 -11.91 3 1 HIS A 95 ? ? -55.81 57.06 4 1 SER B 3 ? ? -119.72 -89.30 5 1 ASN B 20 ? ? -103.43 41.58 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 PRO A 5 ? ? PHE A 6 ? ? 50.86 2 1 TYR B 18 ? ? ASP B 19 ? ? -70.88 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A LYS 2 ? A LYS 2 3 1 Y 1 A HIS 97 ? A HIS 97 4 1 Y 1 A HIS 98 ? A HIS 98 5 1 Y 1 A HIS 99 ? A HIS 99 6 1 Y 1 B MSE 1 ? B MSE 1 7 1 Y 1 B LYS 92 ? B LYS 92 8 1 Y 1 B ARG 93 ? B ARG 93 9 1 Y 1 B HIS 94 ? B HIS 94 10 1 Y 1 B HIS 95 ? B HIS 95 11 1 Y 1 B HIS 96 ? B HIS 96 12 1 Y 1 B HIS 97 ? B HIS 97 13 1 Y 1 B HIS 98 ? B HIS 98 14 1 Y 1 B HIS 99 ? B HIS 99 #