data_1TFD # _entry.id 1TFD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1TFD WWPDB D_1000176653 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1TFD _pdbx_database_status.recvd_initial_deposition_date 1990-08-16 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sarra, R.' 1 'Lindley, P.F.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;High-Resolution X-Ray Studies on Rabbit Serum Transferrin: Preliminary Structure Analysis of the N-Terminal Half-Molecule at 2.3 Angstroms Resolution ; 'Acta Crystallogr.,Sect.B' 46 763 ? 1990 ASBSDK DK 0108-7681 0622 ? -1 ? 1 'Molecular Structure of Serum Transferrin at 3.3-Angstroms Resolution' Biochemistry 27 5804 ? 1988 BICHAW US 0006-2960 0033 ? ? ? 2 'Preliminary X-Ray Data for an N-Terminal Fragment of Rabbit Serum Transferrin' J.Mol.Biol. 188 727 ? 1986 JMOBAK UK 0022-2836 0070 ? ? ? 3 'Crystallization and Preliminary X-Ray Investigation of Rabbit Plasma Transferrin' J.Mol.Biol. 108 255 ? 1976 JMOBAK UK 0022-2836 0070 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Sarra, R.' 1 primary 'Garratt, R.' 2 primary 'Gorinsky, B.' 3 primary 'Jhoti, H.' 4 primary 'Lindley, P.' 5 1 'Bailey, S.' 6 1 'Evans, R.W.' 7 1 'Garratt, R.C.' 8 1 'Gorinsky, B.' 9 1 'Hasnain, S.' 10 1 'Horsburgh, C.' 11 1 'Jhoti, H.' 12 1 'Lindley, P.F.' 13 1 'Mydin, A.' 14 1 'Sarra, R.' 15 1 'Watson, J.L.' 16 2 'Sarra, R.' 17 2 'Lindley, P.F.' 18 3 'Al-Hilal, D.' 19 3 'Baker, E.' 20 3 'Carlisle, C.H.' 21 3 'Gorinsky, B.' 22 3 'Horsburgh, R.C.' 23 3 'Lindley, P.F.' 24 3 'Moss, D.S.' 25 3 'Schneider, H.' 26 3 'Stimpson, R.' 27 # _cell.entry_id 1TFD _cell.length_a 67.060 _cell.length_b 67.060 _cell.length_c 138.330 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1TFD _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man TRANSFERRIN 33548.133 1 ? ? ? ? 2 non-polymer syn 'CARBONATE ION' 60.009 1 ? ? ? ? 3 non-polymer syn 'FE (III) ION' 55.845 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VTEKTVRWCAVNDHEASKCANFRDSMKKVLPEDGPRIICVKKASYLDCIKAIAAHEADAVTLDAGLVHEAGLTPNNLKPV VAEFYGSKENPKTFYYAVALVKKGSNFQLNELQGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVASFFSGSCVP CADGADFPQLCQLCPGCGCSSSQPYFGYSGAFKCLKDGLGDVAFVKQETIFENLPSKDERDQYELLCLDNTRKPVDEYEQ CHLARVPSHAVVARSVDGKEDLIWELLNQAQEHFGKDKSGDFQLFSSPHGKNLLFKDSAYGFFK ; _entity_poly.pdbx_seq_one_letter_code_can ;VTEKTVRWCAVNDHEASKCANFRDSMKKVLPEDGPRIICVKKASYLDCIKAIAAHEADAVTLDAGLVHEAGLTPNNLKPV VAEFYGSKENPKTFYYAVALVKKGSNFQLNELQGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVASFFSGSCVP CADGADFPQLCQLCPGCGCSSSQPYFGYSGAFKCLKDGLGDVAFVKQETIFENLPSKDERDQYELLCLDNTRKPVDEYEQ CHLARVPSHAVVARSVDGKEDLIWELLNQAQEHFGKDKSGDFQLFSSPHGKNLLFKDSAYGFFK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 THR n 1 3 GLU n 1 4 LYS n 1 5 THR n 1 6 VAL n 1 7 ARG n 1 8 TRP n 1 9 CYS n 1 10 ALA n 1 11 VAL n 1 12 ASN n 1 13 ASP n 1 14 HIS n 1 15 GLU n 1 16 ALA n 1 17 SER n 1 18 LYS n 1 19 CYS n 1 20 ALA n 1 21 ASN n 1 22 PHE n 1 23 ARG n 1 24 ASP n 1 25 SER n 1 26 MET n 1 27 LYS n 1 28 LYS n 1 29 VAL n 1 30 LEU n 1 31 PRO n 1 32 GLU n 1 33 ASP n 1 34 GLY n 1 35 PRO n 1 36 ARG n 1 37 ILE n 1 38 ILE n 1 39 CYS n 1 40 VAL n 1 41 LYS n 1 42 LYS n 1 43 ALA n 1 44 SER n 1 45 TYR n 1 46 LEU n 1 47 ASP n 1 48 CYS n 1 49 ILE n 1 50 LYS n 1 51 ALA n 1 52 ILE n 1 53 ALA n 1 54 ALA n 1 55 HIS n 1 56 GLU n 1 57 ALA n 1 58 ASP n 1 59 ALA n 1 60 VAL n 1 61 THR n 1 62 LEU n 1 63 ASP n 1 64 ALA n 1 65 GLY n 1 66 LEU n 1 67 VAL n 1 68 HIS n 1 69 GLU n 1 70 ALA n 1 71 GLY n 1 72 LEU n 1 73 THR n 1 74 PRO n 1 75 ASN n 1 76 ASN n 1 77 LEU n 1 78 LYS n 1 79 PRO n 1 80 VAL n 1 81 VAL n 1 82 ALA n 1 83 GLU n 1 84 PHE n 1 85 TYR n 1 86 GLY n 1 87 SER n 1 88 LYS n 1 89 GLU n 1 90 ASN n 1 91 PRO n 1 92 LYS n 1 93 THR n 1 94 PHE n 1 95 TYR n 1 96 TYR n 1 97 ALA n 1 98 VAL n 1 99 ALA n 1 100 LEU n 1 101 VAL n 1 102 LYS n 1 103 LYS n 1 104 GLY n 1 105 SER n 1 106 ASN n 1 107 PHE n 1 108 GLN n 1 109 LEU n 1 110 ASN n 1 111 GLU n 1 112 LEU n 1 113 GLN n 1 114 GLY n 1 115 LYS n 1 116 LYS n 1 117 SER n 1 118 CYS n 1 119 HIS n 1 120 THR n 1 121 GLY n 1 122 LEU n 1 123 GLY n 1 124 ARG n 1 125 SER n 1 126 ALA n 1 127 GLY n 1 128 TRP n 1 129 ASN n 1 130 ILE n 1 131 PRO n 1 132 ILE n 1 133 GLY n 1 134 LEU n 1 135 LEU n 1 136 TYR n 1 137 CYS n 1 138 ASP n 1 139 LEU n 1 140 PRO n 1 141 GLU n 1 142 PRO n 1 143 ARG n 1 144 LYS n 1 145 PRO n 1 146 LEU n 1 147 GLU n 1 148 LYS n 1 149 ALA n 1 150 VAL n 1 151 ALA n 1 152 SER n 1 153 PHE n 1 154 PHE n 1 155 SER n 1 156 GLY n 1 157 SER n 1 158 CYS n 1 159 VAL n 1 160 PRO n 1 161 CYS n 1 162 ALA n 1 163 ASP n 1 164 GLY n 1 165 ALA n 1 166 ASP n 1 167 PHE n 1 168 PRO n 1 169 GLN n 1 170 LEU n 1 171 CYS n 1 172 GLN n 1 173 LEU n 1 174 CYS n 1 175 PRO n 1 176 GLY n 1 177 CYS n 1 178 GLY n 1 179 CYS n 1 180 SER n 1 181 SER n 1 182 SER n 1 183 GLN n 1 184 PRO n 1 185 TYR n 1 186 PHE n 1 187 GLY n 1 188 TYR n 1 189 SER n 1 190 GLY n 1 191 ALA n 1 192 PHE n 1 193 LYS n 1 194 CYS n 1 195 LEU n 1 196 LYS n 1 197 ASP n 1 198 GLY n 1 199 LEU n 1 200 GLY n 1 201 ASP n 1 202 VAL n 1 203 ALA n 1 204 PHE n 1 205 VAL n 1 206 LYS n 1 207 GLN n 1 208 GLU n 1 209 THR n 1 210 ILE n 1 211 PHE n 1 212 GLU n 1 213 ASN n 1 214 LEU n 1 215 PRO n 1 216 SER n 1 217 LYS n 1 218 ASP n 1 219 GLU n 1 220 ARG n 1 221 ASP n 1 222 GLN n 1 223 TYR n 1 224 GLU n 1 225 LEU n 1 226 LEU n 1 227 CYS n 1 228 LEU n 1 229 ASP n 1 230 ASN n 1 231 THR n 1 232 ARG n 1 233 LYS n 1 234 PRO n 1 235 VAL n 1 236 ASP n 1 237 GLU n 1 238 TYR n 1 239 GLU n 1 240 GLN n 1 241 CYS n 1 242 HIS n 1 243 LEU n 1 244 ALA n 1 245 ARG n 1 246 VAL n 1 247 PRO n 1 248 SER n 1 249 HIS n 1 250 ALA n 1 251 VAL n 1 252 VAL n 1 253 ALA n 1 254 ARG n 1 255 SER n 1 256 VAL n 1 257 ASP n 1 258 GLY n 1 259 LYS n 1 260 GLU n 1 261 ASP n 1 262 LEU n 1 263 ILE n 1 264 TRP n 1 265 GLU n 1 266 LEU n 1 267 LEU n 1 268 ASN n 1 269 GLN n 1 270 ALA n 1 271 GLN n 1 272 GLU n 1 273 HIS n 1 274 PHE n 1 275 GLY n 1 276 LYS n 1 277 ASP n 1 278 LYS n 1 279 SER n 1 280 GLY n 1 281 ASP n 1 282 PHE n 1 283 GLN n 1 284 LEU n 1 285 PHE n 1 286 SER n 1 287 SER n 1 288 PRO n 1 289 HIS n 1 290 GLY n 1 291 LYS n 1 292 ASN n 1 293 LEU n 1 294 LEU n 1 295 PHE n 1 296 LYS n 1 297 ASP n 1 298 SER n 1 299 ALA n 1 300 TYR n 1 301 GLY n 1 302 PHE n 1 303 PHE n 1 304 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name rabbit _entity_src_gen.gene_src_genus Oryctolagus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Oryctolagus cuniculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9986 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRFE_RABIT _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P19134 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MRLAAGALLACAALGLCLAVTEKTVRWCAVNDHEASKCANFRDSMKKVLPEDGPRIICVKKASYLDCIKAIAAHEADAVT LDAGLVHEAGLTPNNLKPVVAEFYGSKENPKTFYYAVALVKKGSNFQLNELQGKKSCHTGLGRSAGWNIPIGLLYCDLPE PRKPLEKAVASFFSGSCVPCADGADFPQLCQLCPGCGCSSVQPYFGYSGAFKCLKDGLGDVAFVKQETIFENLPSKDERD QYELLCLDNTRKPVDEYEQCHLARVPSHAVVARSVDGKEDLIWELLNQAQEHFGKDKSGDFQLFSSPHGKNLLFKDSAYG FFKVPPRMDANLYLGYEYVTAVRNLREGICPDPLQDECKAVKWCALSHHERLKCDEWSVTSGGLIECESAETPEDCIAKI MNGEADAMSLDGGYVYIAGQCGLVPVLAENYESTDCKKAPEEGYLSVAVVKKSNPDINWNNLEGKKSCHTAVDRTAGWNI PMGLLYNRINHCRFDEFFRQGCAPGSQKNSSLCELCVGPSVCAPNNREGYYGYTGAFRCLVEKGDVAFVKSQTVLQNTGG RNSEPWAKDLKEEDFELLCLDGTRKPVSEAHNCHLAKAPNHAVVSRKDKAACVKQKLLDLQVEYGNTVADCSSKFCMFHS KTKDLLFRDDTKCLVDLRGKNTYEKYLGADYIKAVSNLRKCSTSRLLEACTFHKH ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1TFD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 304 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P19134 _struct_ref_seq.db_align_beg 20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 323 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 304 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1TFD _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 182 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P19134 _struct_ref_seq_dif.db_mon_id VAL _struct_ref_seq_dif.pdbx_seq_db_seq_num 201 _struct_ref_seq_dif.details CONFLICT _struct_ref_seq_dif.pdbx_auth_seq_num 182 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CO3 non-polymer . 'CARBONATE ION' ? 'C O3 -2' 60.009 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1TFD _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.68 _exptl_crystal.density_percent_sol 54.02 _exptl_crystal.description ? # _refine.entry_id 1TFD _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low ? _refine.ls_d_res_high 2.3 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.225 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2280 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2285 _refine_hist.d_res_high 2.3 _refine_hist.d_res_low . # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function p_bond_d 0.017 ? ? ? 'X-RAY DIFFRACTION' ? p_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1TFD _struct.title ;HIGH-RESOLUTION X-RAY STUDIES ON RABBIT SERUM TRANSFERRIN: PRELIMINARY STRUCTURE ANALYSIS OF THE N-TERMINAL HALF-MOLECULE AT 2.3 ANGSTROMS RESOLUTION ; _struct.pdbx_descriptor 'TRANSFERRIN (N-TERMINAL HALF-MOLECULE)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1TFD _struct_keywords.pdbx_keywords 'IRON TRANSPORT PROTEIN' _struct_keywords.text 'IRON TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 12 ? LYS A 27 ? ASN A 12 LYS A 27 1 ? 16 HELX_P HELX_P2 2 SER A 44 ? ALA A 54 ? SER A 44 ALA A 54 1 ? 11 HELX_P HELX_P3 3 ASP A 63 ? LEU A 72 ? ASP A 63 LEU A 72 1 ? 10 HELX_P HELX_P4 4 TRP A 128 ? TYR A 136 ? TRP A 128 TYR A 136 1 ? 9 HELX_P HELX_P5 5 PRO A 145 ? SER A 152 ? PRO A 145 SER A 152 1 ? 8 HELX_P HELX_P6 6 GLY A 187 ? LYS A 196 ? GLY A 187 LYS A 196 1 ? 10 HELX_P HELX_P7 7 GLU A 208 ? LEU A 214 ? GLU A 208 LEU A 214 1 ? 7 HELX_P HELX_P8 8 SER A 216 ? ASP A 221 ? SER A 216 ASP A 221 1 ? 6 HELX_P HELX_P9 9 LYS A 259 ? ALA A 270 ? LYS A 259 ALA A 270 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 48 SG ? ? A CYS 9 A CYS 48 1_555 ? ? ? ? ? ? ? 2.039 ? disulf2 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 19 A CYS 39 1_555 ? ? ? ? ? ? ? 2.038 ? disulf3 disulf ? ? A CYS 118 SG ? ? ? 1_555 A CYS 194 SG ? ? A CYS 118 A CYS 194 1_555 ? ? ? ? ? ? ? 2.038 ? disulf4 disulf ? ? A CYS 158 SG ? ? ? 1_555 A CYS 174 SG ? ? A CYS 158 A CYS 174 1_555 ? ? ? ? ? ? ? 2.042 ? disulf5 disulf ? ? A CYS 161 SG ? ? ? 1_555 A CYS 179 SG ? ? A CYS 161 A CYS 179 1_555 ? ? ? ? ? ? ? 2.052 ? disulf6 disulf ? ? A CYS 171 SG ? ? ? 1_555 A CYS 177 SG ? ? A CYS 171 A CYS 177 1_555 ? ? ? ? ? ? ? 2.038 ? disulf7 disulf ? ? A CYS 227 SG ? ? ? 1_555 A CYS 241 SG ? ? A CYS 227 A CYS 241 1_555 ? ? ? ? ? ? ? 2.038 ? metalc1 metalc ? ? C FE . FE ? ? ? 1_555 A ASP 63 OD1 ? ? A FE 950 A ASP 63 1_555 ? ? ? ? ? ? ? 1.891 ? metalc2 metalc ? ? C FE . FE ? ? ? 1_555 A HIS 249 NE2 ? ? A FE 950 A HIS 249 1_555 ? ? ? ? ? ? ? 2.204 ? metalc3 metalc ? ? C FE . FE ? ? ? 1_555 A TYR 95 OH ? ? A FE 950 A TYR 95 1_555 ? ? ? ? ? ? ? 2.097 ? metalc4 metalc ? ? C FE . FE ? ? ? 1_555 A TYR 188 OH ? ? A FE 950 A TYR 188 1_555 ? ? ? ? ? ? ? 2.041 ? metalc5 metalc ? ? C FE . FE ? ? ? 1_555 B CO3 . O1 ? ? A FE 950 A CO3 900 1_555 ? ? ? ? ? ? ? 2.078 ? metalc6 metalc ? ? C FE . FE ? ? ? 1_555 B CO3 . O3 ? ? A FE 950 A CO3 900 1_555 ? ? ? ? ? ? ? 2.056 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 4 ? C ? 6 ? D ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel C 1 2 ? parallel C 2 3 ? parallel C 3 4 ? anti-parallel C 4 5 ? anti-parallel C 5 6 ? anti-parallel D 1 2 ? parallel D 2 3 ? parallel D 3 4 ? anti-parallel D 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 9 ? ALA A 10 ? CYS A 9 ALA A 10 A 2 VAL A 40 ? LYS A 41 ? VAL A 40 LYS A 41 B 1 VAL A 60 ? LEU A 62 ? VAL A 60 LEU A 62 B 2 ALA A 250 ? ARG A 254 ? ALA A 250 ARG A 254 B 3 LEU A 77 ? GLU A 83 ? LEU A 77 GLU A 83 B 4 PHE A 302 ? PHE A 303 ? PHE A 302 PHE A 303 C 1 SER A 157 ? CYS A 158 ? SER A 157 CYS A 158 C 2 SER A 117 ? CYS A 118 ? SER A 117 CYS A 118 C 3 VAL A 202 ? LYS A 206 ? VAL A 202 LYS A 206 C 4 TYR A 95 ? LYS A 102 ? TYR A 95 LYS A 102 C 5 TYR A 223 ? CYS A 227 ? TYR A 223 CYS A 227 C 6 THR A 231 ? PRO A 234 ? THR A 231 PRO A 234 D 1 SER A 157 ? CYS A 158 ? SER A 157 CYS A 158 D 2 SER A 117 ? CYS A 118 ? SER A 117 CYS A 118 D 3 VAL A 202 ? LYS A 206 ? VAL A 202 LYS A 206 D 4 TYR A 95 ? LYS A 102 ? TYR A 95 LYS A 102 D 5 ALA A 244 ? VAL A 246 ? ALA A 244 VAL A 246 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ALA A 10 ? N ALA A 10 O VAL A 40 ? O VAL A 40 B 1 2 N LEU A 62 ? N LEU A 62 O ALA A 250 ? O ALA A 250 B 2 3 O ALA A 253 ? O ALA A 253 N LYS A 78 ? N LYS A 78 B 3 4 N ALA A 82 ? N ALA A 82 O PHE A 303 ? O PHE A 303 C 1 2 N CYS A 158 ? N CYS A 158 O SER A 117 ? O SER A 117 C 2 3 N CYS A 118 ? N CYS A 118 O VAL A 202 ? O VAL A 202 C 3 4 O VAL A 205 ? O VAL A 205 N VAL A 98 ? N VAL A 98 C 4 5 N VAL A 101 ? N VAL A 101 O GLU A 224 ? O GLU A 224 C 5 6 N CYS A 227 ? N CYS A 227 O THR A 231 ? O THR A 231 D 1 2 N CYS A 158 ? N CYS A 158 O SER A 117 ? O SER A 117 D 2 3 N CYS A 118 ? N CYS A 118 O VAL A 202 ? O VAL A 202 D 3 4 O VAL A 205 ? O VAL A 205 N VAL A 98 ? N VAL A 98 D 4 5 N ALA A 97 ? N ALA A 97 O ALA A 244 ? O ALA A 244 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CO3 A 900' AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FE A 950' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 ASP A 63 ? ASP A 63 . ? 1_555 ? 2 AC1 10 TYR A 95 ? TYR A 95 . ? 1_555 ? 3 AC1 10 THR A 120 ? THR A 120 . ? 1_555 ? 4 AC1 10 ARG A 124 ? ARG A 124 . ? 1_555 ? 5 AC1 10 SER A 125 ? SER A 125 . ? 1_555 ? 6 AC1 10 ALA A 126 ? ALA A 126 . ? 1_555 ? 7 AC1 10 GLY A 127 ? GLY A 127 . ? 1_555 ? 8 AC1 10 TYR A 188 ? TYR A 188 . ? 1_555 ? 9 AC1 10 HIS A 249 ? HIS A 249 . ? 1_555 ? 10 AC1 10 FE C . ? FE A 950 . ? 1_555 ? 11 AC2 5 ASP A 63 ? ASP A 63 . ? 1_555 ? 12 AC2 5 TYR A 95 ? TYR A 95 . ? 1_555 ? 13 AC2 5 TYR A 188 ? TYR A 188 . ? 1_555 ? 14 AC2 5 HIS A 249 ? HIS A 249 . ? 1_555 ? 15 AC2 5 CO3 B . ? CO3 A 900 . ? 1_555 ? # _database_PDB_matrix.entry_id 1TFD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1TFD _atom_sites.fract_transf_matrix[1][1] 0.014912 _atom_sites.fract_transf_matrix[1][2] 0.008609 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017219 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007229 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # _atom_sites_footnote.id 1 _atom_sites_footnote.text ;THE DISULFIDE BRIDGE NORMALLY PRESENT BETWEEN RESIDUES CYS 137 AND CYS 331 COULD NOT BE BUILT BECAUSE RESIDUE 331 IS NOT PRESENT IN THIS STRUCTURE. ; # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 LYS 4 4 ? ? ? A . n A 1 5 THR 5 5 ? ? ? A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 TRP 8 8 8 TRP TRP A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 CYS 118 118 118 CYS CYS A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 TRP 128 128 128 TRP TRP A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 PRO 131 131 131 PRO PRO A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 TYR 136 136 136 TYR TYR A . n A 1 137 CYS 137 137 137 CYS CYS A . n A 1 138 ASP 138 138 138 ASP ASP A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 PRO 140 140 140 PRO PRO A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 PRO 142 142 142 PRO PRO A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 SER 157 157 157 SER SER A . n A 1 158 CYS 158 158 158 CYS CYS A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 CYS 161 161 161 CYS CYS A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 GLY 164 164 ? ? ? A . n A 1 165 ALA 165 165 ? ? ? A . n A 1 166 ASP 166 166 ? ? ? A . n A 1 167 PHE 167 167 ? ? ? A . n A 1 168 PRO 168 168 ? ? ? A . n A 1 169 GLN 169 169 169 GLN GLN A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 CYS 171 171 171 CYS CYS A . n A 1 172 GLN 172 172 172 GLN GLN A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 CYS 174 174 174 CYS CYS A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 CYS 177 177 177 CYS CYS A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 CYS 179 179 179 CYS CYS A . n A 1 180 SER 180 180 180 SER SER A . n A 1 181 SER 181 181 181 SER SER A . n A 1 182 SER 182 182 182 SER SER A . n A 1 183 GLN 183 183 183 GLN GLN A . n A 1 184 PRO 184 184 184 PRO PRO A . n A 1 185 TYR 185 185 185 TYR TYR A . n A 1 186 PHE 186 186 186 PHE PHE A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 TYR 188 188 188 TYR TYR A . n A 1 189 SER 189 189 189 SER SER A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 PHE 192 192 192 PHE PHE A . n A 1 193 LYS 193 193 193 LYS LYS A . n A 1 194 CYS 194 194 194 CYS CYS A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 ASP 197 197 197 ASP ASP A . n A 1 198 GLY 198 198 198 GLY GLY A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 GLY 200 200 200 GLY GLY A . n A 1 201 ASP 201 201 201 ASP ASP A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 PHE 204 204 204 PHE PHE A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 LYS 206 206 206 LYS LYS A . n A 1 207 GLN 207 207 207 GLN GLN A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 THR 209 209 209 THR THR A . n A 1 210 ILE 210 210 210 ILE ILE A . n A 1 211 PHE 211 211 211 PHE PHE A . n A 1 212 GLU 212 212 212 GLU GLU A . n A 1 213 ASN 213 213 213 ASN ASN A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 PRO 215 215 215 PRO PRO A . n A 1 216 SER 216 216 216 SER SER A . n A 1 217 LYS 217 217 217 LYS LYS A . n A 1 218 ASP 218 218 218 ASP ASP A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 ARG 220 220 220 ARG ARG A . n A 1 221 ASP 221 221 221 ASP ASP A . n A 1 222 GLN 222 222 222 GLN GLN A . n A 1 223 TYR 223 223 223 TYR TYR A . n A 1 224 GLU 224 224 224 GLU GLU A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 LEU 226 226 226 LEU LEU A . n A 1 227 CYS 227 227 227 CYS CYS A . n A 1 228 LEU 228 228 228 LEU LEU A . n A 1 229 ASP 229 229 229 ASP ASP A . n A 1 230 ASN 230 230 230 ASN ASN A . n A 1 231 THR 231 231 231 THR THR A . n A 1 232 ARG 232 232 232 ARG ARG A . n A 1 233 LYS 233 233 233 LYS LYS A . n A 1 234 PRO 234 234 234 PRO PRO A . n A 1 235 VAL 235 235 235 VAL VAL A . n A 1 236 ASP 236 236 236 ASP ASP A . n A 1 237 GLU 237 237 237 GLU GLU A . n A 1 238 TYR 238 238 238 TYR TYR A . n A 1 239 GLU 239 239 239 GLU GLU A . n A 1 240 GLN 240 240 240 GLN GLN A . n A 1 241 CYS 241 241 241 CYS CYS A . n A 1 242 HIS 242 242 242 HIS HIS A . n A 1 243 LEU 243 243 243 LEU LEU A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 ARG 245 245 245 ARG ARG A . n A 1 246 VAL 246 246 246 VAL VAL A . n A 1 247 PRO 247 247 247 PRO PRO A . n A 1 248 SER 248 248 248 SER SER A . n A 1 249 HIS 249 249 249 HIS HIS A . n A 1 250 ALA 250 250 250 ALA ALA A . n A 1 251 VAL 251 251 251 VAL VAL A . n A 1 252 VAL 252 252 252 VAL VAL A . n A 1 253 ALA 253 253 253 ALA ALA A . n A 1 254 ARG 254 254 254 ARG ARG A . n A 1 255 SER 255 255 255 SER SER A . n A 1 256 VAL 256 256 256 VAL VAL A . n A 1 257 ASP 257 257 257 ASP ASP A . n A 1 258 GLY 258 258 258 GLY GLY A . n A 1 259 LYS 259 259 259 LYS LYS A . n A 1 260 GLU 260 260 260 GLU GLU A . n A 1 261 ASP 261 261 261 ASP ASP A . n A 1 262 LEU 262 262 262 LEU LEU A . n A 1 263 ILE 263 263 263 ILE ILE A . n A 1 264 TRP 264 264 264 TRP TRP A . n A 1 265 GLU 265 265 265 GLU GLU A . n A 1 266 LEU 266 266 266 LEU LEU A . n A 1 267 LEU 267 267 267 LEU LEU A . n A 1 268 ASN 268 268 268 ASN ASN A . n A 1 269 GLN 269 269 269 GLN GLN A . n A 1 270 ALA 270 270 270 ALA ALA A . n A 1 271 GLN 271 271 271 GLN GLN A . n A 1 272 GLU 272 272 272 GLU GLU A . n A 1 273 HIS 273 273 273 HIS HIS A . n A 1 274 PHE 274 274 274 PHE PHE A . n A 1 275 GLY 275 275 275 GLY GLY A . n A 1 276 LYS 276 276 276 LYS LYS A . n A 1 277 ASP 277 277 277 ASP ASP A . n A 1 278 LYS 278 278 278 LYS LYS A . n A 1 279 SER 279 279 279 SER SER A . n A 1 280 GLY 280 280 280 GLY GLY A . n A 1 281 ASP 281 281 281 ASP ASP A . n A 1 282 PHE 282 282 282 PHE PHE A . n A 1 283 GLN 283 283 283 GLN GLN A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 PHE 285 285 285 PHE PHE A . n A 1 286 SER 286 286 286 SER SER A . n A 1 287 SER 287 287 287 SER SER A . n A 1 288 PRO 288 288 288 PRO PRO A . n A 1 289 HIS 289 289 289 HIS HIS A . n A 1 290 GLY 290 290 290 GLY GLY A . n A 1 291 LYS 291 291 291 LYS LYS A . n A 1 292 ASN 292 292 292 ASN ASN A . n A 1 293 LEU 293 293 293 LEU LEU A . n A 1 294 LEU 294 294 294 LEU LEU A . n A 1 295 PHE 295 295 295 PHE PHE A . n A 1 296 LYS 296 296 296 LYS LYS A . n A 1 297 ASP 297 297 297 ASP ASP A . n A 1 298 SER 298 298 298 SER SER A . n A 1 299 ALA 299 299 299 ALA ALA A . n A 1 300 TYR 300 300 300 TYR TYR A . n A 1 301 GLY 301 301 301 GLY GLY A . n A 1 302 PHE 302 302 302 PHE PHE A . n A 1 303 PHE 303 303 303 PHE PHE A . n A 1 304 LYS 304 304 304 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CO3 1 900 900 CO3 CO3 A . C 3 FE 1 950 950 FE FE A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 FE ? C FE . ? A FE 950 ? 1_555 NE2 ? A HIS 249 ? A HIS 249 ? 1_555 75.2 ? 2 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 FE ? C FE . ? A FE 950 ? 1_555 OH ? A TYR 95 ? A TYR 95 ? 1_555 95.4 ? 3 NE2 ? A HIS 249 ? A HIS 249 ? 1_555 FE ? C FE . ? A FE 950 ? 1_555 OH ? A TYR 95 ? A TYR 95 ? 1_555 78.8 ? 4 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 FE ? C FE . ? A FE 950 ? 1_555 OH ? A TYR 188 ? A TYR 188 ? 1_555 162.7 ? 5 NE2 ? A HIS 249 ? A HIS 249 ? 1_555 FE ? C FE . ? A FE 950 ? 1_555 OH ? A TYR 188 ? A TYR 188 ? 1_555 101.7 ? 6 OH ? A TYR 95 ? A TYR 95 ? 1_555 FE ? C FE . ? A FE 950 ? 1_555 OH ? A TYR 188 ? A TYR 188 ? 1_555 100.7 ? 7 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 FE ? C FE . ? A FE 950 ? 1_555 O1 ? B CO3 . ? A CO3 900 ? 1_555 81.1 ? 8 NE2 ? A HIS 249 ? A HIS 249 ? 1_555 FE ? C FE . ? A FE 950 ? 1_555 O1 ? B CO3 . ? A CO3 900 ? 1_555 156.3 ? 9 OH ? A TYR 95 ? A TYR 95 ? 1_555 FE ? C FE . ? A FE 950 ? 1_555 O1 ? B CO3 . ? A CO3 900 ? 1_555 104.0 ? 10 OH ? A TYR 188 ? A TYR 188 ? 1_555 FE ? C FE . ? A FE 950 ? 1_555 O1 ? B CO3 . ? A CO3 900 ? 1_555 100.9 ? 11 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 FE ? C FE . ? A FE 950 ? 1_555 O3 ? B CO3 . ? A CO3 900 ? 1_555 93.1 ? 12 NE2 ? A HIS 249 ? A HIS 249 ? 1_555 FE ? C FE . ? A FE 950 ? 1_555 O3 ? B CO3 . ? A CO3 900 ? 1_555 114.7 ? 13 OH ? A TYR 95 ? A TYR 95 ? 1_555 FE ? C FE . ? A FE 950 ? 1_555 O3 ? B CO3 . ? A CO3 900 ? 1_555 165.6 ? 14 OH ? A TYR 188 ? A TYR 188 ? 1_555 FE ? C FE . ? A FE 950 ? 1_555 O3 ? B CO3 . ? A CO3 900 ? 1_555 72.5 ? 15 O1 ? B CO3 . ? A CO3 900 ? 1_555 FE ? C FE . ? A FE 950 ? 1_555 O3 ? B CO3 . ? A CO3 900 ? 1_555 65.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1993-04-15 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # _software.name RESTRAIN _software.classification refinement _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ASP 33 ? ? O A GLY 34 ? ? 1.60 2 1 CD1 A LEU 199 ? ? N A VAL 202 ? ? 1.69 3 1 O A GLY 280 ? ? N A PHE 282 ? ? 1.71 4 1 O A GLU 141 ? ? N A ARG 143 ? ? 1.72 5 1 O A PRO 247 ? ? CB A SER 248 ? ? 1.79 6 1 N A GLN 183 ? ? CE1 A TYR 185 ? ? 1.85 7 1 CA A ASP 163 ? ? OE1 A GLN 169 ? ? 1.85 8 1 CD1 A LEU 195 ? ? CD2 A LEU 199 ? ? 1.98 9 1 OG A SER 182 ? ? CD2 A TYR 185 ? ? 1.99 10 1 N A ASP 163 ? ? OE1 A GLN 169 ? ? 2.02 11 1 OG A SER 87 ? ? N A ASN 90 ? ? 2.03 12 1 O A LEU 199 ? ? N A ASP 201 ? ? 2.03 13 1 CA A GLN 183 ? ? CE1 A TYR 185 ? ? 2.13 14 1 C A GLN 183 ? ? CE1 A TYR 185 ? ? 2.13 15 1 O A LYS 42 ? ? N A SER 44 ? ? 2.13 16 1 OG A SER 87 ? ? N A GLU 89 ? ? 2.17 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OD2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ASP _pdbx_validate_symm_contact.auth_seq_id_1 236 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OD2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ASP _pdbx_validate_symm_contact.auth_seq_id_2 236 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_467 _pdbx_validate_symm_contact.dist 2.05 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 N A CYS 19 ? ? CA A CYS 19 ? ? 1.324 1.459 -0.135 0.020 N 2 1 CA A CYS 161 ? ? C A CYS 161 ? ? 1.712 1.525 0.187 0.026 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG A ARG 7 ? ? CD A ARG 7 ? ? NE A ARG 7 ? ? 129.63 111.80 17.83 2.10 N 2 1 NE A ARG 23 ? ? CZ A ARG 23 ? ? NH2 A ARG 23 ? ? 123.96 120.30 3.66 0.50 N 3 1 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH2 A ARG 36 ? ? 124.11 120.30 3.81 0.50 N 4 1 C A ASP 63 ? ? N A ALA 64 ? ? CA A ALA 64 ? ? 105.85 121.70 -15.85 2.50 Y 5 1 C A THR 73 ? ? N A PRO 74 ? ? CA A PRO 74 ? ? 133.07 119.30 13.77 1.50 Y 6 1 O A PHE 84 ? ? C A PHE 84 ? ? N A TYR 85 ? ? 134.30 122.70 11.60 1.60 Y 7 1 CA A TYR 85 ? ? C A TYR 85 ? ? N A GLY 86 ? ? 132.19 116.20 15.99 2.00 Y 8 1 O A TYR 85 ? ? C A TYR 85 ? ? N A GLY 86 ? ? 106.07 123.20 -17.13 1.70 Y 9 1 CB A SER 87 ? ? CA A SER 87 ? ? C A SER 87 ? ? 97.44 110.10 -12.66 1.90 N 10 1 O A SER 87 ? ? C A SER 87 ? ? N A LYS 88 ? ? 133.29 122.70 10.59 1.60 Y 11 1 O A HIS 119 ? ? C A HIS 119 ? ? N A THR 120 ? ? 135.42 122.70 12.72 1.60 Y 12 1 NE A ARG 124 ? ? CZ A ARG 124 ? ? NH2 A ARG 124 ? ? 123.99 120.30 3.69 0.50 N 13 1 CB A LEU 139 ? ? CA A LEU 139 ? ? C A LEU 139 ? ? 98.25 110.20 -11.95 1.90 N 14 1 NE A ARG 143 ? ? CZ A ARG 143 ? ? NH2 A ARG 143 ? ? 123.89 120.30 3.59 0.50 N 15 1 CB A CYS 171 ? ? CA A CYS 171 ? ? C A CYS 171 ? ? 97.37 110.40 -13.03 2.00 N 16 1 N A CYS 171 ? ? CA A CYS 171 ? ? CB A CYS 171 ? ? 94.84 110.60 -15.76 1.80 N 17 1 CB A TYR 185 ? ? CG A TYR 185 ? ? CD1 A TYR 185 ? ? 116.33 121.00 -4.67 0.60 N 18 1 CA A TYR 188 ? ? C A TYR 188 ? ? N A SER 189 ? ? 103.60 117.20 -13.60 2.20 Y 19 1 O A TYR 188 ? ? C A TYR 188 ? ? N A SER 189 ? ? 135.52 122.70 12.82 1.60 Y 20 1 O A VAL 205 ? ? C A VAL 205 ? ? N A LYS 206 ? ? 134.56 122.70 11.86 1.60 Y 21 1 NE A ARG 220 ? ? CZ A ARG 220 ? ? NH2 A ARG 220 ? ? 123.97 120.30 3.67 0.50 N 22 1 CA A ASP 229 ? ? C A ASP 229 ? ? N A ASN 230 ? ? 102.74 117.20 -14.46 2.20 Y 23 1 O A ASP 229 ? ? C A ASP 229 ? ? N A ASN 230 ? ? 136.48 122.70 13.78 1.60 Y 24 1 NE A ARG 232 ? ? CZ A ARG 232 ? ? NH2 A ARG 232 ? ? 123.94 120.30 3.64 0.50 N 25 1 NE A ARG 245 ? ? CZ A ARG 245 ? ? NH2 A ARG 245 ? ? 123.88 120.30 3.58 0.50 N 26 1 O A VAL 252 ? ? C A VAL 252 ? ? N A ALA 253 ? ? 132.39 122.70 9.69 1.60 Y 27 1 NE A ARG 254 ? ? CZ A ARG 254 ? ? NH2 A ARG 254 ? ? 124.09 120.30 3.79 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 12 ? ? 78.67 -172.42 2 1 PRO A 31 ? ? -41.31 167.25 3 1 GLU A 32 ? ? -62.34 66.69 4 1 ASP A 33 ? ? 154.18 -86.00 5 1 PRO A 35 ? ? -6.58 -73.47 6 1 ARG A 36 ? ? 65.75 86.26 7 1 LYS A 42 ? ? -147.57 59.58 8 1 ALA A 43 ? ? 32.14 -42.68 9 1 THR A 73 ? ? 63.64 155.47 10 1 PRO A 74 ? ? -27.17 11.48 11 1 ASN A 75 ? ? 142.14 71.64 12 1 ASN A 76 ? ? -109.31 -160.17 13 1 VAL A 80 ? ? -132.37 -33.79 14 1 TYR A 85 ? ? -62.42 30.96 15 1 PRO A 91 ? ? -25.97 -107.57 16 1 LYS A 92 ? ? 110.65 114.20 17 1 THR A 93 ? ? -103.30 53.26 18 1 LYS A 103 ? ? -38.28 126.66 19 1 ASN A 106 ? ? 0.33 45.14 20 1 LEU A 112 ? ? -49.90 -10.81 21 1 GLN A 113 ? ? -16.49 -100.48 22 1 SER A 125 ? ? -57.98 -76.25 23 1 TRP A 128 ? ? -151.65 -53.12 24 1 TYR A 136 ? ? -76.15 -163.80 25 1 CYS A 137 ? ? 85.01 -56.50 26 1 PRO A 140 ? ? -28.53 133.24 27 1 PRO A 142 ? ? -35.37 58.76 28 1 LYS A 144 ? ? -32.42 -87.87 29 1 PHE A 154 ? ? -79.73 -138.75 30 1 SER A 155 ? ? -174.34 26.70 31 1 CYS A 174 ? ? -150.61 74.31 32 1 PRO A 175 ? ? -49.42 103.31 33 1 SER A 180 ? ? 95.98 -29.43 34 1 GLN A 183 ? ? -87.92 -91.51 35 1 PRO A 184 ? ? -67.28 10.71 36 1 PHE A 186 ? ? 93.84 -122.41 37 1 LYS A 196 ? ? -66.03 57.13 38 1 ASP A 197 ? ? 113.71 111.33 39 1 ASP A 201 ? ? 5.91 38.61 40 1 VAL A 205 ? ? -125.56 -168.45 41 1 ASN A 230 ? ? 2.76 70.29 42 1 GLU A 237 ? ? -109.16 74.13 43 1 SER A 248 ? ? 129.44 154.14 44 1 ARG A 254 ? ? -39.90 150.99 45 1 ASP A 257 ? ? 98.93 5.27 46 1 LYS A 259 ? ? -107.46 53.07 47 1 LEU A 266 ? ? -56.64 -80.13 48 1 LYS A 276 ? ? -66.28 -73.05 49 1 ASP A 281 ? ? 35.82 -40.19 50 1 PHE A 282 ? ? -77.84 -88.37 51 1 GLN A 283 ? ? 78.78 109.84 52 1 LEU A 284 ? ? -55.90 -72.90 53 1 PHE A 285 ? ? -81.92 36.96 54 1 SER A 286 ? ? 178.07 154.46 55 1 LYS A 291 ? ? -79.39 -91.77 56 1 ASN A 292 ? ? -101.36 63.38 57 1 LEU A 294 ? ? 76.66 -33.32 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 1 ? A VAL 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A LYS 4 ? A LYS 4 5 1 Y 1 A THR 5 ? A THR 5 6 1 Y 1 A GLY 164 ? A GLY 164 7 1 Y 1 A ALA 165 ? A ALA 165 8 1 Y 1 A ASP 166 ? A ASP 166 9 1 Y 1 A PHE 167 ? A PHE 167 10 1 Y 1 A PRO 168 ? A PRO 168 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CARBONATE ION' CO3 3 'FE (III) ION' FE #