data_1TRG # _entry.id 1TRG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1TRG WWPDB D_1000176803 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1TRG _pdbx_database_status.recvd_initial_deposition_date 1998-05-21 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Stout, T.J.' 1 'Sage, C.R.' 2 'Stroud, R.M.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'The additivity of substrate fragments in enzyme-ligand binding.' Structure 6 839 848 1998 STRUE6 UK 0969-2126 2005 ? 9687366 '10.1016/S0969-2126(98)00086-0' 1 'Water-Mediated Substrate/Product Discrimination: The Product Complex of Thymidylate Synthase at 1.83 A' Biochemistry 33 1502 ? 1994 BICHAW US 0006-2960 0033 ? ? ? 2 'Structure, Multiple Site Binding, and Segmental Accommodation in Thymidylate Synthase on Binding Dump and an Anti-Folate' Biochemistry 29 6964 ? 1990 BICHAW US 0006-2960 0033 ? ? ? 3 'Erratum. Structure, Multiple Site Binding, and Segmental Accommodation in Thymidylate Synthase on Binding Dump and an Anti-Folate' Biochemistry 29 10864 ? 1990 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Stout, T.J.' 1 primary 'Sage, C.R.' 2 primary 'Stroud, R.M.' 3 1 'Fauman, E.B.' 4 1 'Rutenber, E.E.' 5 1 'Maley, G.F.' 6 1 'Maley, F.' 7 1 'Stroud, R.M.' 8 2 'Montfort, W.R.' 9 2 'Perry, K.M.' 10 2 'Fauman, E.B.' 11 2 'Finer-Moore, J.S.' 12 2 'Maley, G.F.' 13 2 'Hardy, L.' 14 2 'Maley, F.' 15 2 'Stroud, R.M.' 16 3 'Montfort, W.R.' 17 3 'Perry, K.M.' 18 3 'Fauman, E.B.' 19 3 'Finer-Moore, J.S.' 20 3 'Maley, G.F.' 21 3 'Hardy, L.' 22 3 'Maley, F.' 23 3 'Stroud, R.M.' 24 # _cell.entry_id 1TRG _cell.length_a 71.960 _cell.length_b 71.960 _cell.length_c 115.100 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1TRG _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'THYMIDYLATE SYNTHASE' 30543.662 1 2.1.1.45 ? ? ? 2 non-polymer syn ;2'-DEOXYURIDINE 5'-MONOPHOSPHATE ; 308.182 1 ? ? ? ? 3 non-polymer syn '10-PROPARGYL-5,8-DIDEAZAFOLIC ACID' 477.469 1 ? ? ? ? 4 water nat water 18.015 127 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(FMT)MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHEN NVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVA DGKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRK PESIFDYRFEDFEIEGYDPHPGIKAPVAI ; _entity_poly.pdbx_seq_one_letter_code_can ;XMKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTI WDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKL SCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESI FDYRFEDFEIEGYDPHPGIKAPVAI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 FMT n 1 2 MET n 1 3 LYS n 1 4 GLN n 1 5 TYR n 1 6 LEU n 1 7 GLU n 1 8 LEU n 1 9 MET n 1 10 GLN n 1 11 LYS n 1 12 VAL n 1 13 LEU n 1 14 ASP n 1 15 GLU n 1 16 GLY n 1 17 THR n 1 18 GLN n 1 19 LYS n 1 20 ASN n 1 21 ASP n 1 22 ARG n 1 23 THR n 1 24 GLY n 1 25 THR n 1 26 GLY n 1 27 THR n 1 28 LEU n 1 29 SER n 1 30 ILE n 1 31 PHE n 1 32 GLY n 1 33 HIS n 1 34 GLN n 1 35 MET n 1 36 ARG n 1 37 PHE n 1 38 ASN n 1 39 LEU n 1 40 GLN n 1 41 ASP n 1 42 GLY n 1 43 PHE n 1 44 PRO n 1 45 LEU n 1 46 VAL n 1 47 THR n 1 48 THR n 1 49 LYS n 1 50 ARG n 1 51 CYS n 1 52 HIS n 1 53 LEU n 1 54 ARG n 1 55 SER n 1 56 ILE n 1 57 ILE n 1 58 HIS n 1 59 GLU n 1 60 LEU n 1 61 LEU n 1 62 TRP n 1 63 PHE n 1 64 LEU n 1 65 GLN n 1 66 GLY n 1 67 ASP n 1 68 THR n 1 69 ASN n 1 70 ILE n 1 71 ALA n 1 72 TYR n 1 73 LEU n 1 74 HIS n 1 75 GLU n 1 76 ASN n 1 77 ASN n 1 78 VAL n 1 79 THR n 1 80 ILE n 1 81 TRP n 1 82 ASP n 1 83 GLU n 1 84 TRP n 1 85 ALA n 1 86 ASP n 1 87 GLU n 1 88 ASN n 1 89 GLY n 1 90 ASP n 1 91 LEU n 1 92 GLY n 1 93 PRO n 1 94 VAL n 1 95 TYR n 1 96 GLY n 1 97 LYS n 1 98 GLN n 1 99 TRP n 1 100 ARG n 1 101 ALA n 1 102 TRP n 1 103 PRO n 1 104 THR n 1 105 PRO n 1 106 ASP n 1 107 GLY n 1 108 ARG n 1 109 HIS n 1 110 ILE n 1 111 ASP n 1 112 GLN n 1 113 ILE n 1 114 THR n 1 115 THR n 1 116 VAL n 1 117 LEU n 1 118 ASN n 1 119 GLN n 1 120 LEU n 1 121 LYS n 1 122 ASN n 1 123 ASP n 1 124 PRO n 1 125 ASP n 1 126 SER n 1 127 ARG n 1 128 ARG n 1 129 ILE n 1 130 ILE n 1 131 VAL n 1 132 SER n 1 133 ALA n 1 134 TRP n 1 135 ASN n 1 136 VAL n 1 137 GLY n 1 138 GLU n 1 139 LEU n 1 140 ASP n 1 141 LYS n 1 142 MET n 1 143 ALA n 1 144 LEU n 1 145 ALA n 1 146 PRO n 1 147 CYS n 1 148 HIS n 1 149 ALA n 1 150 PHE n 1 151 PHE n 1 152 GLN n 1 153 PHE n 1 154 TYR n 1 155 VAL n 1 156 ALA n 1 157 ASP n 1 158 GLY n 1 159 LYS n 1 160 LEU n 1 161 SER n 1 162 CYS n 1 163 GLN n 1 164 LEU n 1 165 TYR n 1 166 GLN n 1 167 ARG n 1 168 SER n 1 169 CYS n 1 170 ASP n 1 171 VAL n 1 172 PHE n 1 173 LEU n 1 174 GLY n 1 175 LEU n 1 176 PRO n 1 177 PHE n 1 178 ASN n 1 179 ILE n 1 180 ALA n 1 181 SER n 1 182 TYR n 1 183 ALA n 1 184 LEU n 1 185 LEU n 1 186 VAL n 1 187 HIS n 1 188 MET n 1 189 MET n 1 190 ALA n 1 191 GLN n 1 192 GLN n 1 193 CYS n 1 194 ASP n 1 195 LEU n 1 196 GLU n 1 197 VAL n 1 198 GLY n 1 199 ASP n 1 200 PHE n 1 201 VAL n 1 202 TRP n 1 203 THR n 1 204 GLY n 1 205 GLY n 1 206 ASP n 1 207 THR n 1 208 HIS n 1 209 LEU n 1 210 TYR n 1 211 SER n 1 212 ASN n 1 213 HIS n 1 214 MET n 1 215 ASP n 1 216 GLN n 1 217 THR n 1 218 HIS n 1 219 LEU n 1 220 GLN n 1 221 LEU n 1 222 SER n 1 223 ARG n 1 224 GLU n 1 225 PRO n 1 226 ARG n 1 227 PRO n 1 228 LEU n 1 229 PRO n 1 230 LYS n 1 231 LEU n 1 232 ILE n 1 233 ILE n 1 234 LYS n 1 235 ARG n 1 236 LYS n 1 237 PRO n 1 238 GLU n 1 239 SER n 1 240 ILE n 1 241 PHE n 1 242 ASP n 1 243 TYR n 1 244 ARG n 1 245 PHE n 1 246 GLU n 1 247 ASP n 1 248 PHE n 1 249 GLU n 1 250 ILE n 1 251 GLU n 1 252 GLY n 1 253 TYR n 1 254 ASP n 1 255 PRO n 1 256 HIS n 1 257 PRO n 1 258 GLY n 1 259 ILE n 1 260 LYS n 1 261 ALA n 1 262 PRO n 1 263 VAL n 1 264 ALA n 1 265 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene THYA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line X2913 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene THYA _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'BLUESCRIPT VECTOR' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PTHYA-WT _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TYSY_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P0A884 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIW DEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLS CQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF DYRFEDFEIEGYDPHPGIKAPVAI ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1TRG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 265 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A884 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 264 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 264 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CB3 non-polymer . '10-PROPARGYL-5,8-DIDEAZAFOLIC ACID' ? 'C24 H23 N5 O6' 477.469 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FMT non-polymer . 'FORMIC ACID' ? 'C H2 O2' 46.025 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UMP non-polymer . ;2'-DEOXYURIDINE 5'-MONOPHOSPHATE ; DUMP 'C9 H13 N2 O8 P' 308.182 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1TRG _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.82 _exptl_crystal.density_percent_sol 52.4 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 8.0' # _diffrn.id 1 _diffrn.ambient_temp 287 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IIC' _diffrn_detector.pdbx_collection_date 1995-11-29 _diffrn_detector.details COLLIMATOR # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'GRAPHITE(002)' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH2R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1TRG _reflns.observed_criterion_sigma_I 1. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 1.90 _reflns.number_obs 37807 _reflns.number_all ? _reflns.percent_possible_obs 77.4 _reflns.pdbx_Rmerge_I_obs 0.0970000 _reflns.pdbx_Rsym_value 0.0970000 _reflns.pdbx_netI_over_sigmaI 14.2 _reflns.B_iso_Wilson_estimate 8.1 _reflns.pdbx_redundancy 3.1 _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.90 _reflns_shell.d_res_low 1.98 _reflns_shell.percent_possible_all 45.0 _reflns_shell.Rmerge_I_obs 0.2750000 _reflns_shell.pdbx_Rsym_value 0.3210000 _reflns_shell.meanI_over_sigI_obs 3.1 _reflns_shell.pdbx_redundancy 1.2 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1TRG _refine.ls_number_reflns_obs 20071 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF 10000000.00 _refine.pdbx_data_cutoff_low_absF 0.00100 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 7.00 _refine.ls_d_res_high 1.90 _refine.ls_percent_reflns_obs 73.9 _refine.ls_R_factor_obs 0.1800000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1800000 _refine.ls_R_factor_R_free 0.2300000 _refine.ls_R_factor_R_free_error 0.006 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.9 _refine.ls_number_reflns_R_free 1995 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 20.9 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'ONE MONOMER OF PDB ENTRY 1KCE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1TRG _refine_analyze.Luzzati_coordinate_error_obs 0.29 _refine_analyze.Luzzati_sigma_a_obs 0.36 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.31 _refine_analyze.Luzzati_sigma_a_free 0.40 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2153 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 55 _refine_hist.number_atoms_solvent 127 _refine_hist.number_atoms_total 2335 _refine_hist.d_res_high 1.90 _refine_hist.d_res_low 7.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.5 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 24.5 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.18 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it 2.51 1.50 ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it 3.44 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scbond_it 3.37 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scangle_it 4.91 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.d_res_high 1.90 _refine_ls_shell.d_res_low 1.98 _refine_ls_shell.number_reflns_R_work 1206 _refine_ls_shell.R_factor_R_work 0.2950000 _refine_ls_shell.percent_reflns_obs 40.6 _refine_ls_shell.R_factor_R_free 0.2970000 _refine_ls_shell.R_factor_R_free_error 0.026 _refine_ls_shell.percent_reflns_R_free 11.1 _refine_ls_shell.number_reflns_R_free 151 _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 2 PARAM11.WAT TOPH11.WAT 'X-RAY DIFFRACTION' 3 PARAMED.LIG TOPO_COV.DUMP 'X-RAY DIFFRACTION' 4 ? TOPO.CB3 'X-RAY DIFFRACTION' # _struct.entry_id 1TRG _struct.title ;E. COLI THYMIDYLATE SYNTHASE IN SYMMETRIC COMPLEX WITH CB3717 AND 2'-DEOXYURIDINE 5'-MONOPHOSPHATE (DUMP) ; _struct.pdbx_descriptor ;THYMIDYLATE SYNTHASE, 2'-DEOXYURIDINE 5'-MONOPHOSPHATE, 10-PROPARGYL-5,8-DIDEAZAFOLIC ACID ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1TRG _struct_keywords.pdbx_keywords METHYLTRANSFERASE _struct_keywords.text 'METHYLTRANSFERASE, SYMMETRIC TERNARY COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 3 ? GLU A 15 ? LYS A 2 GLU A 14 1 ? 13 HELX_P HELX_P2 2 LEU A 39 ? ASP A 41 ? LEU A 38 ASP A 40 5 ? 3 HELX_P HELX_P3 3 LEU A 53 ? GLN A 65 ? LEU A 52 GLN A 64 1 ? 13 HELX_P HELX_P4 4 ALA A 71 ? ASN A 76 ? ALA A 70 ASN A 75 1 ? 6 HELX_P HELX_P5 5 ASP A 82 ? TRP A 84 ? ASP A 81 TRP A 83 5 ? 3 HELX_P HELX_P6 6 TYR A 95 ? ALA A 101 ? TYR A 94 ALA A 100 1 ? 7 HELX_P HELX_P7 7 GLN A 112 ? ASN A 122 ? GLN A 111 ASN A 121 1 ? 11 HELX_P HELX_P8 8 VAL A 136 ? LYS A 141 ? VAL A 135 LYS A 140 5 ? 6 HELX_P HELX_P9 9 GLY A 174 ? GLN A 192 ? GLY A 173 GLN A 191 1 ? 19 HELX_P HELX_P10 10 SER A 211 ? SER A 222 ? SER A 210 SER A 221 5 ? 12 HELX_P HELX_P11 11 ILE A 240 ? ASP A 242 ? ILE A 239 ASP A 241 5 ? 3 HELX_P HELX_P12 12 PHE A 245 ? ASP A 247 ? PHE A 244 ASP A 246 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A FMT 1 C ? ? ? 1_555 A MET 2 N ? ? A FMT 0 A MET 1 1_555 ? ? ? ? ? ? ? 1.328 ? covale2 covale ? ? B UMP . C6 ? ? ? 1_555 A CYS 147 SG ? ? A UMP 565 A CYS 146 1_555 ? ? ? ? ? ? ? 1.854 ? covale3 covale ? ? A FMT 1 O2 ? ? ? 1_555 A MET 2 N ? ? A FMT 0 A MET 1 1_555 ? ? ? ? ? ? ? 2.013 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 5 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel B 1 2 ? anti-parallel B 2 3 ? parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 17 ? LYS A 19 ? THR A 16 LYS A 18 A 2 THR A 27 ? PHE A 31 ? THR A 26 PHE A 30 A 3 ASP A 206 ? TYR A 210 ? ASP A 205 TYR A 209 A 4 SER A 168 ? ASP A 170 ? SER A 167 ASP A 169 B 1 HIS A 33 ? ASN A 38 ? HIS A 32 ASN A 37 B 2 ASP A 199 ? GLY A 204 ? ASP A 198 GLY A 203 B 3 LYS A 159 ? GLN A 166 ? LYS A 158 GLN A 165 B 4 HIS A 148 ? ALA A 156 ? HIS A 147 ALA A 155 B 5 ILE A 130 ? SER A 132 ? ILE A 129 SER A 131 C 1 LYS A 230 ? ILE A 233 ? LYS A 229 ILE A 232 C 2 PHE A 248 ? GLU A 251 ? PHE A 247 GLU A 250 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O THR A 17 ? O THR A 16 N SER A 29 ? N SER A 28 A 2 3 O LEU A 28 ? O LEU A 27 N LEU A 209 ? N LEU A 208 A 3 4 O ASP A 206 ? O ASP A 205 N CYS A 169 ? N CYS A 168 B 1 2 O HIS A 33 ? O HIS A 32 N GLY A 204 ? N GLY A 203 B 2 3 O VAL A 201 ? O VAL A 200 N CYS A 162 ? N CYS A 161 B 3 4 O LYS A 159 ? O LYS A 158 N ALA A 156 ? N ALA A 155 B 4 5 O PHE A 151 ? O PHE A 150 N VAL A 131 ? N VAL A 130 C 1 2 O LYS A 230 ? O LYS A 229 N GLU A 251 ? N GLU A 250 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details CAT Unknown ? ? ? ? 1 'CATALYTIC CYSTEINE FORMS A COVALENT BOND WITH THE SUBSTRATE, DUMP.' AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE UMP A 565' AC2 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE CB3 A 566' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 CAT 1 CYS A 147 ? CYS A 146 . ? 1_555 ? 2 AC1 15 ARG A 22 ? ARG A 21 . ? 1_555 ? 3 AC1 15 ARG A 127 ? ARG A 126 . ? 5_555 ? 4 AC1 15 ARG A 128 ? ARG A 127 . ? 5_555 ? 5 AC1 15 CYS A 147 ? CYS A 146 . ? 1_555 ? 6 AC1 15 HIS A 148 ? HIS A 147 . ? 1_555 ? 7 AC1 15 GLN A 166 ? GLN A 165 . ? 1_555 ? 8 AC1 15 ARG A 167 ? ARG A 166 . ? 1_555 ? 9 AC1 15 SER A 168 ? SER A 167 . ? 1_555 ? 10 AC1 15 ASP A 170 ? ASP A 169 . ? 1_555 ? 11 AC1 15 ASN A 178 ? ASN A 177 . ? 1_555 ? 12 AC1 15 HIS A 208 ? HIS A 207 . ? 1_555 ? 13 AC1 15 TYR A 210 ? TYR A 209 . ? 1_555 ? 14 AC1 15 CB3 C . ? CB3 A 566 . ? 1_555 ? 15 AC1 15 HOH D . ? HOH A 708 . ? 1_555 ? 16 AC1 15 HOH D . ? HOH A 729 . ? 1_555 ? 17 AC2 23 HIS A 52 ? HIS A 51 . ? 1_555 ? 18 AC2 23 GLU A 59 ? GLU A 58 . ? 1_555 ? 19 AC2 23 ILE A 80 ? ILE A 79 . ? 1_555 ? 20 AC2 23 TRP A 81 ? TRP A 80 . ? 1_555 ? 21 AC2 23 TRP A 84 ? TRP A 83 . ? 1_555 ? 22 AC2 23 LEU A 144 ? LEU A 143 . ? 1_555 ? 23 AC2 23 ASP A 170 ? ASP A 169 . ? 1_555 ? 24 AC2 23 GLY A 174 ? GLY A 173 . ? 1_555 ? 25 AC2 23 PHE A 177 ? PHE A 176 . ? 1_555 ? 26 AC2 23 ASN A 178 ? ASN A 177 . ? 1_555 ? 27 AC2 23 TYR A 210 ? TYR A 209 . ? 1_555 ? 28 AC2 23 VAL A 263 ? VAL A 262 . ? 1_555 ? 29 AC2 23 ALA A 264 ? ALA A 263 . ? 1_555 ? 30 AC2 23 UMP B . ? UMP A 565 . ? 1_555 ? 31 AC2 23 HOH D . ? HOH A 715 . ? 1_555 ? 32 AC2 23 HOH D . ? HOH A 717 . ? 1_555 ? 33 AC2 23 HOH D . ? HOH A 720 . ? 1_555 ? 34 AC2 23 HOH D . ? HOH A 722 . ? 1_555 ? 35 AC2 23 HOH D . ? HOH A 724 . ? 1_555 ? 36 AC2 23 HOH D . ? HOH A 728 . ? 1_555 ? 37 AC2 23 HOH D . ? HOH A 738 . ? 1_555 ? 38 AC2 23 HOH D . ? HOH A 739 . ? 1_555 ? 39 AC2 23 HOH D . ? HOH A 811 . ? 1_555 ? # _database_PDB_matrix.entry_id 1TRG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1TRG _atom_sites.fract_transf_matrix[1][1] 0.013897 _atom_sites.fract_transf_matrix[1][2] 0.008023 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016046 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008688 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 FMT 1 0 0 FMT CBX A . n A 1 2 MET 2 1 1 MET MET A . n A 1 3 LYS 3 2 2 LYS LYS A . n A 1 4 GLN 4 3 3 GLN GLN A . n A 1 5 TYR 5 4 4 TYR TYR A . n A 1 6 LEU 6 5 5 LEU LEU A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 LEU 8 7 7 LEU LEU A . n A 1 9 MET 9 8 8 MET MET A . n A 1 10 GLN 10 9 9 GLN GLN A . n A 1 11 LYS 11 10 10 LYS LYS A . n A 1 12 VAL 12 11 11 VAL VAL A . n A 1 13 LEU 13 12 12 LEU LEU A . n A 1 14 ASP 14 13 13 ASP ASP A . n A 1 15 GLU 15 14 14 GLU GLU A . n A 1 16 GLY 16 15 15 GLY GLY A . n A 1 17 THR 17 16 16 THR THR A . n A 1 18 GLN 18 17 17 GLN GLN A . n A 1 19 LYS 19 18 18 LYS LYS A . n A 1 20 ASN 20 19 19 ASN ASN A . n A 1 21 ASP 21 20 20 ASP ASP A . n A 1 22 ARG 22 21 21 ARG ARG A . n A 1 23 THR 23 22 22 THR THR A . n A 1 24 GLY 24 23 23 GLY GLY A . n A 1 25 THR 25 24 24 THR THR A . n A 1 26 GLY 26 25 25 GLY GLY A . n A 1 27 THR 27 26 26 THR THR A . n A 1 28 LEU 28 27 27 LEU LEU A . n A 1 29 SER 29 28 28 SER SER A . n A 1 30 ILE 30 29 29 ILE ILE A . n A 1 31 PHE 31 30 30 PHE PHE A . n A 1 32 GLY 32 31 31 GLY GLY A . n A 1 33 HIS 33 32 32 HIS HIS A . n A 1 34 GLN 34 33 33 GLN GLN A . n A 1 35 MET 35 34 34 MET MET A . n A 1 36 ARG 36 35 35 ARG ARG A . n A 1 37 PHE 37 36 36 PHE PHE A . n A 1 38 ASN 38 37 37 ASN ASN A . n A 1 39 LEU 39 38 38 LEU LEU A . n A 1 40 GLN 40 39 39 GLN GLN A . n A 1 41 ASP 41 40 40 ASP ASP A . n A 1 42 GLY 42 41 41 GLY GLY A . n A 1 43 PHE 43 42 42 PHE PHE A . n A 1 44 PRO 44 43 43 PRO PRO A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 VAL 46 45 45 VAL VAL A . n A 1 47 THR 47 46 46 THR THR A . n A 1 48 THR 48 47 47 THR THR A . n A 1 49 LYS 49 48 48 LYS LYS A . n A 1 50 ARG 50 49 49 ARG ARG A . n A 1 51 CYS 51 50 50 CYS CYS A . n A 1 52 HIS 52 51 51 HIS HIS A . n A 1 53 LEU 53 52 52 LEU LEU A . n A 1 54 ARG 54 53 53 ARG ARG A . n A 1 55 SER 55 54 54 SER SER A . n A 1 56 ILE 56 55 55 ILE ILE A . n A 1 57 ILE 57 56 56 ILE ILE A . n A 1 58 HIS 58 57 57 HIS HIS A . n A 1 59 GLU 59 58 58 GLU GLU A . n A 1 60 LEU 60 59 59 LEU LEU A . n A 1 61 LEU 61 60 60 LEU LEU A . n A 1 62 TRP 62 61 61 TRP TRP A . n A 1 63 PHE 63 62 62 PHE PHE A . n A 1 64 LEU 64 63 63 LEU LEU A . n A 1 65 GLN 65 64 64 GLN GLN A . n A 1 66 GLY 66 65 65 GLY GLY A . n A 1 67 ASP 67 66 66 ASP ASP A . n A 1 68 THR 68 67 67 THR THR A . n A 1 69 ASN 69 68 68 ASN ASN A . n A 1 70 ILE 70 69 69 ILE ILE A . n A 1 71 ALA 71 70 70 ALA ALA A . n A 1 72 TYR 72 71 71 TYR TYR A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 HIS 74 73 73 HIS HIS A . n A 1 75 GLU 75 74 74 GLU GLU A . n A 1 76 ASN 76 75 75 ASN ASN A . n A 1 77 ASN 77 76 76 ASN ASN A . n A 1 78 VAL 78 77 77 VAL VAL A . n A 1 79 THR 79 78 78 THR THR A . n A 1 80 ILE 80 79 79 ILE ILE A . n A 1 81 TRP 81 80 80 TRP TRP A . n A 1 82 ASP 82 81 81 ASP ASP A . n A 1 83 GLU 83 82 82 GLU GLU A . n A 1 84 TRP 84 83 83 TRP TRP A . n A 1 85 ALA 85 84 84 ALA ALA A . n A 1 86 ASP 86 85 85 ASP ASP A . n A 1 87 GLU 87 86 86 GLU GLU A . n A 1 88 ASN 88 87 87 ASN ASN A . n A 1 89 GLY 89 88 88 GLY GLY A . n A 1 90 ASP 90 89 89 ASP ASP A . n A 1 91 LEU 91 90 90 LEU LEU A . n A 1 92 GLY 92 91 91 GLY GLY A . n A 1 93 PRO 93 92 92 PRO PRO A . n A 1 94 VAL 94 93 93 VAL VAL A . n A 1 95 TYR 95 94 94 TYR TYR A . n A 1 96 GLY 96 95 95 GLY GLY A . n A 1 97 LYS 97 96 96 LYS LYS A . n A 1 98 GLN 98 97 97 GLN GLN A . n A 1 99 TRP 99 98 98 TRP TRP A . n A 1 100 ARG 100 99 99 ARG ARG A . n A 1 101 ALA 101 100 100 ALA ALA A . n A 1 102 TRP 102 101 101 TRP TRP A . n A 1 103 PRO 103 102 102 PRO PRO A . n A 1 104 THR 104 103 103 THR THR A . n A 1 105 PRO 105 104 104 PRO PRO A . n A 1 106 ASP 106 105 105 ASP ASP A . n A 1 107 GLY 107 106 106 GLY GLY A . n A 1 108 ARG 108 107 107 ARG ARG A . n A 1 109 HIS 109 108 108 HIS HIS A . n A 1 110 ILE 110 109 109 ILE ILE A . n A 1 111 ASP 111 110 110 ASP ASP A . n A 1 112 GLN 112 111 111 GLN GLN A . n A 1 113 ILE 113 112 112 ILE ILE A . n A 1 114 THR 114 113 113 THR THR A . n A 1 115 THR 115 114 114 THR THR A . n A 1 116 VAL 116 115 115 VAL VAL A . n A 1 117 LEU 117 116 116 LEU LEU A . n A 1 118 ASN 118 117 117 ASN ASN A . n A 1 119 GLN 119 118 118 GLN GLN A . n A 1 120 LEU 120 119 119 LEU LEU A . n A 1 121 LYS 121 120 120 LYS LYS A . n A 1 122 ASN 122 121 121 ASN ASN A . n A 1 123 ASP 123 122 122 ASP ASP A . n A 1 124 PRO 124 123 123 PRO PRO A . n A 1 125 ASP 125 124 124 ASP ASP A . n A 1 126 SER 126 125 125 SER SER A . n A 1 127 ARG 127 126 126 ARG ARG A . n A 1 128 ARG 128 127 127 ARG ARG A . n A 1 129 ILE 129 128 128 ILE ILE A . n A 1 130 ILE 130 129 129 ILE ILE A . n A 1 131 VAL 131 130 130 VAL VAL A . n A 1 132 SER 132 131 131 SER SER A . n A 1 133 ALA 133 132 132 ALA ALA A . n A 1 134 TRP 134 133 133 TRP TRP A . n A 1 135 ASN 135 134 134 ASN ASN A . n A 1 136 VAL 136 135 135 VAL VAL A . n A 1 137 GLY 137 136 136 GLY GLY A . n A 1 138 GLU 138 137 137 GLU GLU A . n A 1 139 LEU 139 138 138 LEU LEU A . n A 1 140 ASP 140 139 139 ASP ASP A . n A 1 141 LYS 141 140 140 LYS LYS A . n A 1 142 MET 142 141 141 MET MET A . n A 1 143 ALA 143 142 142 ALA ALA A . n A 1 144 LEU 144 143 143 LEU LEU A . n A 1 145 ALA 145 144 144 ALA ALA A . n A 1 146 PRO 146 145 145 PRO PRO A . n A 1 147 CYS 147 146 146 CYS CYS A . n A 1 148 HIS 148 147 147 HIS HIS A . n A 1 149 ALA 149 148 148 ALA ALA A . n A 1 150 PHE 150 149 149 PHE PHE A . n A 1 151 PHE 151 150 150 PHE PHE A . n A 1 152 GLN 152 151 151 GLN GLN A . n A 1 153 PHE 153 152 152 PHE PHE A . n A 1 154 TYR 154 153 153 TYR TYR A . n A 1 155 VAL 155 154 154 VAL VAL A . n A 1 156 ALA 156 155 155 ALA ALA A . n A 1 157 ASP 157 156 156 ASP ASP A . n A 1 158 GLY 158 157 157 GLY GLY A . n A 1 159 LYS 159 158 158 LYS LYS A . n A 1 160 LEU 160 159 159 LEU LEU A . n A 1 161 SER 161 160 160 SER SER A . n A 1 162 CYS 162 161 161 CYS CYS A . n A 1 163 GLN 163 162 162 GLN GLN A . n A 1 164 LEU 164 163 163 LEU LEU A . n A 1 165 TYR 165 164 164 TYR TYR A . n A 1 166 GLN 166 165 165 GLN GLN A . n A 1 167 ARG 167 166 166 ARG ARG A . n A 1 168 SER 168 167 167 SER SER A . n A 1 169 CYS 169 168 168 CYS CYS A . n A 1 170 ASP 170 169 169 ASP ASP A . n A 1 171 VAL 171 170 170 VAL VAL A . n A 1 172 PHE 172 171 171 PHE PHE A . n A 1 173 LEU 173 172 172 LEU LEU A . n A 1 174 GLY 174 173 173 GLY GLY A . n A 1 175 LEU 175 174 174 LEU LEU A . n A 1 176 PRO 176 175 175 PRO PRO A . n A 1 177 PHE 177 176 176 PHE PHE A . n A 1 178 ASN 178 177 177 ASN ASN A . n A 1 179 ILE 179 178 178 ILE ILE A . n A 1 180 ALA 180 179 179 ALA ALA A . n A 1 181 SER 181 180 180 SER SER A . n A 1 182 TYR 182 181 181 TYR TYR A . n A 1 183 ALA 183 182 182 ALA ALA A . n A 1 184 LEU 184 183 183 LEU LEU A . n A 1 185 LEU 185 184 184 LEU LEU A . n A 1 186 VAL 186 185 185 VAL VAL A . n A 1 187 HIS 187 186 186 HIS HIS A . n A 1 188 MET 188 187 187 MET MET A . n A 1 189 MET 189 188 188 MET MET A . n A 1 190 ALA 190 189 189 ALA ALA A . n A 1 191 GLN 191 190 190 GLN GLN A . n A 1 192 GLN 192 191 191 GLN GLN A . n A 1 193 CYS 193 192 192 CYS CYS A . n A 1 194 ASP 194 193 193 ASP ASP A . n A 1 195 LEU 195 194 194 LEU LEU A . n A 1 196 GLU 196 195 195 GLU GLU A . n A 1 197 VAL 197 196 196 VAL VAL A . n A 1 198 GLY 198 197 197 GLY GLY A . n A 1 199 ASP 199 198 198 ASP ASP A . n A 1 200 PHE 200 199 199 PHE PHE A . n A 1 201 VAL 201 200 200 VAL VAL A . n A 1 202 TRP 202 201 201 TRP TRP A . n A 1 203 THR 203 202 202 THR THR A . n A 1 204 GLY 204 203 203 GLY GLY A . n A 1 205 GLY 205 204 204 GLY GLY A . n A 1 206 ASP 206 205 205 ASP ASP A . n A 1 207 THR 207 206 206 THR THR A . n A 1 208 HIS 208 207 207 HIS HIS A . n A 1 209 LEU 209 208 208 LEU LEU A . n A 1 210 TYR 210 209 209 TYR TYR A . n A 1 211 SER 211 210 210 SER SER A . n A 1 212 ASN 212 211 211 ASN ASN A . n A 1 213 HIS 213 212 212 HIS HIS A . n A 1 214 MET 214 213 213 MET MET A . n A 1 215 ASP 215 214 214 ASP ASP A . n A 1 216 GLN 216 215 215 GLN GLN A . n A 1 217 THR 217 216 216 THR THR A . n A 1 218 HIS 218 217 217 HIS HIS A . n A 1 219 LEU 219 218 218 LEU LEU A . n A 1 220 GLN 220 219 219 GLN GLN A . n A 1 221 LEU 221 220 220 LEU LEU A . n A 1 222 SER 222 221 221 SER SER A . n A 1 223 ARG 223 222 222 ARG ARG A . n A 1 224 GLU 224 223 223 GLU GLU A . n A 1 225 PRO 225 224 224 PRO PRO A . n A 1 226 ARG 226 225 225 ARG ARG A . n A 1 227 PRO 227 226 226 PRO PRO A . n A 1 228 LEU 228 227 227 LEU LEU A . n A 1 229 PRO 229 228 228 PRO PRO A . n A 1 230 LYS 230 229 229 LYS LYS A . n A 1 231 LEU 231 230 230 LEU LEU A . n A 1 232 ILE 232 231 231 ILE ILE A . n A 1 233 ILE 233 232 232 ILE ILE A . n A 1 234 LYS 234 233 233 LYS LYS A . n A 1 235 ARG 235 234 234 ARG ARG A . n A 1 236 LYS 236 235 235 LYS LYS A . n A 1 237 PRO 237 236 236 PRO PRO A . n A 1 238 GLU 238 237 237 GLU GLU A . n A 1 239 SER 239 238 238 SER SER A . n A 1 240 ILE 240 239 239 ILE ILE A . n A 1 241 PHE 241 240 240 PHE PHE A . n A 1 242 ASP 242 241 241 ASP ASP A . n A 1 243 TYR 243 242 242 TYR TYR A . n A 1 244 ARG 244 243 243 ARG ARG A . n A 1 245 PHE 245 244 244 PHE PHE A . n A 1 246 GLU 246 245 245 GLU GLU A . n A 1 247 ASP 247 246 246 ASP ASP A . n A 1 248 PHE 248 247 247 PHE PHE A . n A 1 249 GLU 249 248 248 GLU GLU A . n A 1 250 ILE 250 249 249 ILE ILE A . n A 1 251 GLU 251 250 250 GLU GLU A . n A 1 252 GLY 252 251 251 GLY GLY A . n A 1 253 TYR 253 252 252 TYR TYR A . n A 1 254 ASP 254 253 253 ASP ASP A . n A 1 255 PRO 255 254 254 PRO PRO A . n A 1 256 HIS 256 255 255 HIS HIS A . n A 1 257 PRO 257 256 256 PRO PRO A . n A 1 258 GLY 258 257 257 GLY GLY A . n A 1 259 ILE 259 258 258 ILE ILE A . n A 1 260 LYS 260 259 259 LYS LYS A . n A 1 261 ALA 261 260 260 ALA ALA A . n A 1 262 PRO 262 261 261 PRO PRO A . n A 1 263 VAL 263 262 262 VAL VAL A . n A 1 264 ALA 264 263 263 ALA ALA A . n A 1 265 ILE 265 264 264 ILE ILE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 8340 ? 1 MORE -23 ? 1 'SSA (A^2)' 18920 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 x-y,-y,-z+2/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 76.7333333333 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-08-12 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal AMoRE phasing . ? 1 X-PLOR refinement 3.854 ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 94 ? ? -22.66 -67.33 2 1 ALA A 100 ? ? -146.98 56.47 3 1 ASP A 122 ? ? -155.45 64.57 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;2'-DEOXYURIDINE 5'-MONOPHOSPHATE ; UMP 3 '10-PROPARGYL-5,8-DIDEAZAFOLIC ACID' CB3 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 UMP 1 565 565 UMP UMP A . C 3 CB3 1 566 566 CB3 CB3 A . D 4 HOH 1 700 700 HOH HOH A . D 4 HOH 2 701 701 HOH HOH A . D 4 HOH 3 702 702 HOH HOH A . D 4 HOH 4 703 703 HOH HOH A . D 4 HOH 5 704 704 HOH HOH A . D 4 HOH 6 705 705 HOH HOH A . D 4 HOH 7 706 706 HOH HOH A . D 4 HOH 8 707 707 HOH HOH A . D 4 HOH 9 708 708 HOH HOH A . D 4 HOH 10 709 709 HOH HOH A . D 4 HOH 11 710 710 HOH HOH A . D 4 HOH 12 711 711 HOH HOH A . D 4 HOH 13 712 712 HOH HOH A . D 4 HOH 14 713 713 HOH HOH A . D 4 HOH 15 714 714 HOH HOH A . D 4 HOH 16 715 715 HOH HOH A . D 4 HOH 17 716 716 HOH HOH A . D 4 HOH 18 717 717 HOH HOH A . D 4 HOH 19 718 718 HOH HOH A . D 4 HOH 20 719 719 HOH HOH A . D 4 HOH 21 720 720 HOH HOH A . D 4 HOH 22 721 721 HOH HOH A . D 4 HOH 23 722 722 HOH HOH A . D 4 HOH 24 723 723 HOH HOH A . D 4 HOH 25 724 724 HOH HOH A . D 4 HOH 26 725 725 HOH HOH A . D 4 HOH 27 726 726 HOH HOH A . D 4 HOH 28 727 727 HOH HOH A . D 4 HOH 29 728 728 HOH HOH A . D 4 HOH 30 729 729 HOH HOH A . D 4 HOH 31 730 730 HOH HOH A . D 4 HOH 32 731 731 HOH HOH A . D 4 HOH 33 732 732 HOH HOH A . D 4 HOH 34 733 733 HOH HOH A . D 4 HOH 35 734 734 HOH HOH A . D 4 HOH 36 735 735 HOH HOH A . D 4 HOH 37 736 736 HOH HOH A . D 4 HOH 38 737 737 HOH HOH A . D 4 HOH 39 738 738 HOH HOH A . D 4 HOH 40 739 739 HOH HOH A . D 4 HOH 41 740 740 HOH HOH A . D 4 HOH 42 741 741 HOH HOH A . D 4 HOH 43 742 742 HOH HOH A . D 4 HOH 44 743 743 HOH HOH A . D 4 HOH 45 744 744 HOH HOH A . D 4 HOH 46 745 745 HOH HOH A . D 4 HOH 47 746 746 HOH HOH A . D 4 HOH 48 747 747 HOH HOH A . D 4 HOH 49 748 748 HOH HOH A . D 4 HOH 50 749 749 HOH HOH A . D 4 HOH 51 750 750 HOH HOH A . D 4 HOH 52 751 751 HOH HOH A . D 4 HOH 53 752 752 HOH HOH A . D 4 HOH 54 753 753 HOH HOH A . D 4 HOH 55 754 754 HOH HOH A . D 4 HOH 56 755 755 HOH HOH A . D 4 HOH 57 756 756 HOH HOH A . D 4 HOH 58 757 757 HOH HOH A . D 4 HOH 59 758 758 HOH HOH A . D 4 HOH 60 759 759 HOH HOH A . D 4 HOH 61 760 760 HOH HOH A . D 4 HOH 62 761 761 HOH HOH A . D 4 HOH 63 762 762 HOH HOH A . D 4 HOH 64 763 763 HOH HOH A . D 4 HOH 65 764 764 HOH HOH A . D 4 HOH 66 765 765 HOH HOH A . D 4 HOH 67 766 766 HOH HOH A . D 4 HOH 68 767 767 HOH HOH A . D 4 HOH 69 768 768 HOH HOH A . D 4 HOH 70 769 769 HOH HOH A . D 4 HOH 71 770 770 HOH HOH A . D 4 HOH 72 771 771 HOH HOH A . D 4 HOH 73 773 773 HOH HOH A . D 4 HOH 74 774 774 HOH HOH A . D 4 HOH 75 775 775 HOH HOH A . D 4 HOH 76 776 776 HOH HOH A . D 4 HOH 77 777 777 HOH HOH A . D 4 HOH 78 778 778 HOH HOH A . D 4 HOH 79 779 779 HOH HOH A . D 4 HOH 80 780 780 HOH HOH A . D 4 HOH 81 781 781 HOH HOH A . D 4 HOH 82 782 782 HOH HOH A . D 4 HOH 83 783 783 HOH HOH A . D 4 HOH 84 785 785 HOH HOH A . D 4 HOH 85 786 786 HOH HOH A . D 4 HOH 86 787 787 HOH HOH A . D 4 HOH 87 788 788 HOH HOH A . D 4 HOH 88 789 789 HOH HOH A . D 4 HOH 89 790 790 HOH HOH A . D 4 HOH 90 791 791 HOH HOH A . D 4 HOH 91 793 793 HOH HOH A . D 4 HOH 92 794 794 HOH HOH A . D 4 HOH 93 795 795 HOH HOH A . D 4 HOH 94 798 798 HOH HOH A . D 4 HOH 95 801 801 HOH HOH A . D 4 HOH 96 802 802 HOH HOH A . D 4 HOH 97 803 803 HOH HOH A . D 4 HOH 98 805 805 HOH HOH A . D 4 HOH 99 806 806 HOH HOH A . D 4 HOH 100 807 807 HOH HOH A . D 4 HOH 101 808 808 HOH HOH A . D 4 HOH 102 809 809 HOH HOH A . D 4 HOH 103 810 810 HOH HOH A . D 4 HOH 104 811 811 HOH HOH A . D 4 HOH 105 812 812 HOH HOH A . D 4 HOH 106 813 813 HOH HOH A . D 4 HOH 107 814 814 HOH HOH A . D 4 HOH 108 815 815 HOH HOH A . D 4 HOH 109 816 816 HOH HOH A . D 4 HOH 110 818 818 HOH HOH A . D 4 HOH 111 819 819 HOH HOH A . D 4 HOH 112 820 820 HOH HOH A . D 4 HOH 113 822 822 HOH HOH A . D 4 HOH 114 823 823 HOH HOH A . D 4 HOH 115 824 824 HOH HOH A . D 4 HOH 116 825 825 HOH HOH A . D 4 HOH 117 827 827 HOH HOH A . D 4 HOH 118 828 828 HOH HOH A . D 4 HOH 119 829 829 HOH HOH A . D 4 HOH 120 832 832 HOH HOH A . D 4 HOH 121 833 833 HOH HOH A . D 4 HOH 122 834 834 HOH HOH A . D 4 HOH 123 836 836 HOH HOH A . D 4 HOH 124 837 837 HOH HOH A . D 4 HOH 125 838 838 HOH HOH A . D 4 HOH 126 839 839 HOH HOH A . D 4 HOH 127 840 840 HOH HOH A . #