data_1UFW # _entry.id 1UFW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1UFW pdb_00001ufw 10.2210/pdb1ufw/pdb RCSB RCSB005783 ? ? WWPDB D_1000005783 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-12-10 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1UFW _pdbx_database_status.recvd_initial_deposition_date 2003-06-10 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk002000339.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'He, F.' 1 'Muto, Y.' 2 'Ushikoshi, R.' 3 'Shirouzu, M.' 4 'Terada, T.' 5 'Kigawa, T.' 6 'Inoue, M.' 7 'Yabuki, T.' 8 'Aoki, M.' 9 'Seki, E.' 10 'Matsuda, T.' 11 'Hirota, H.' 12 'Yoshida, M.' 13 'Kobayashi, N.' 14 'Tanaka, A.' 15 'Osanai, T.' 16 'Matsuo, Y.' 17 'Ohara, O.' 18 'Nagase, T.' 19 'Kikuno, R.' 20 'Nakayama, M.' 21 'Yokoyama, S.' 22 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 23 # _citation.id primary _citation.title 'Solution structure of RNP domain in Synaptojanin 2' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'He, F.' 1 ? primary 'Muto, Y.' 2 ? primary 'Ushikoshi, R.' 3 ? primary 'Shirouzu, M.' 4 ? primary 'Terada, T.' 5 ? primary 'Kigawa, T.' 6 ? primary 'Inoue, M.' 7 ? primary 'Yabuki, T.' 8 ? primary 'Aoki, M.' 9 ? primary 'Seki, E.' 10 ? primary 'Matsuda, T.' 11 ? primary 'Hirota, H.' 12 ? primary 'Yoshida, M.' 13 ? primary 'Kobayashi, N.' 14 ? primary 'Tanaka, A.' 15 ? primary 'Osanai, T.' 16 ? primary 'Matsuo, Y.' 17 ? primary 'Ohara, O.' 18 ? primary 'Nagase, T.' 19 ? primary 'Kikuno, R.' 20 ? primary 'Nakayama, M.' 21 ? primary 'Yokoyama, S.' 22 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Synaptojanin 2' _entity.formula_weight 9935.116 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.1.3.36 _entity.pdbx_mutation ? _entity.pdbx_fragment 'RNP domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGSSFQGPLDATVVVNLQSPTLEEKNEFPEDLRTELMQTLGSYGTIVLVRINQGQMLVTFADSHSALSVLDVDGM KVKGRAVKISGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGSSFQGPLDATVVVNLQSPTLEEKNEFPEDLRTELMQTLGSYGTIVLVRINQGQMLVTFADSHSALSVLDVDGM KVKGRAVKISGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk002000339.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 SER n 1 10 PHE n 1 11 GLN n 1 12 GLY n 1 13 PRO n 1 14 LEU n 1 15 ASP n 1 16 ALA n 1 17 THR n 1 18 VAL n 1 19 VAL n 1 20 VAL n 1 21 ASN n 1 22 LEU n 1 23 GLN n 1 24 SER n 1 25 PRO n 1 26 THR n 1 27 LEU n 1 28 GLU n 1 29 GLU n 1 30 LYS n 1 31 ASN n 1 32 GLU n 1 33 PHE n 1 34 PRO n 1 35 GLU n 1 36 ASP n 1 37 LEU n 1 38 ARG n 1 39 THR n 1 40 GLU n 1 41 LEU n 1 42 MET n 1 43 GLN n 1 44 THR n 1 45 LEU n 1 46 GLY n 1 47 SER n 1 48 TYR n 1 49 GLY n 1 50 THR n 1 51 ILE n 1 52 VAL n 1 53 LEU n 1 54 VAL n 1 55 ARG n 1 56 ILE n 1 57 ASN n 1 58 GLN n 1 59 GLY n 1 60 GLN n 1 61 MET n 1 62 LEU n 1 63 VAL n 1 64 THR n 1 65 PHE n 1 66 ALA n 1 67 ASP n 1 68 SER n 1 69 HIS n 1 70 SER n 1 71 ALA n 1 72 LEU n 1 73 SER n 1 74 VAL n 1 75 LEU n 1 76 ASP n 1 77 VAL n 1 78 ASP n 1 79 GLY n 1 80 MET n 1 81 LYS n 1 82 VAL n 1 83 LYS n 1 84 GLY n 1 85 ARG n 1 86 ALA n 1 87 VAL n 1 88 LYS n 1 89 ILE n 1 90 SER n 1 91 GLY n 1 92 PRO n 1 93 SER n 1 94 SER n 1 95 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'KAZUSA cDNA hg01551' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P021015-22 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 GLY 95 95 95 GLY GLY A . n # _cell.entry_id 1UFW _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1UFW _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1UFW _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1UFW _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1UFW _struct.title 'Solution structure of RNP domain in Synaptojanin 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1UFW _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text 'RNP domain, Synaptojanin 2, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA binding protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SYNJ2_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SSFQGPLDATVVVNLQSPTLEEKNEFPEDLRTELMQTLGSYGTIVLVRINQGQMLVTFADSHSALSVLDVDGMKVKGRAV KI ; _struct_ref.pdbx_align_begin 829 _struct_ref.pdbx_db_accession O15056 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1UFW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 89 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O15056 _struct_ref_seq.db_align_beg 829 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 910 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 89 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1UFW GLY A 1 ? UNP O15056 ? ? 'cloning artifact' 1 1 1 1UFW SER A 2 ? UNP O15056 ? ? 'cloning artifact' 2 2 1 1UFW SER A 3 ? UNP O15056 ? ? 'cloning artifact' 3 3 1 1UFW GLY A 4 ? UNP O15056 ? ? 'cloning artifact' 4 4 1 1UFW SER A 5 ? UNP O15056 ? ? 'cloning artifact' 5 5 1 1UFW SER A 6 ? UNP O15056 ? ? 'cloning artifact' 6 6 1 1UFW GLY A 7 ? UNP O15056 ? ? 'cloning artifact' 7 7 1 1UFW SER A 90 ? UNP O15056 ? ? 'cloning artifact' 90 8 1 1UFW GLY A 91 ? UNP O15056 ? ? 'cloning artifact' 91 9 1 1UFW PRO A 92 ? UNP O15056 ? ? 'cloning artifact' 92 10 1 1UFW SER A 93 ? UNP O15056 ? ? 'cloning artifact' 93 11 1 1UFW SER A 94 ? UNP O15056 ? ? 'cloning artifact' 94 12 1 1UFW GLY A 95 ? UNP O15056 ? ? 'cloning artifact' 95 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 4 ? GLY A 7 ? GLY A 4 GLY A 7 1 ? 4 HELX_P HELX_P2 2 LEU A 27 ? ASN A 31 ? LEU A 27 ASN A 31 1 ? 5 HELX_P HELX_P3 3 GLU A 35 ? TYR A 48 ? GLU A 35 TYR A 48 1 ? 14 HELX_P HELX_P4 4 HIS A 69 ? VAL A 77 ? HIS A 69 VAL A 77 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 53 ? ASN A 57 ? LEU A 53 ASN A 57 A 2 GLN A 60 ? THR A 64 ? GLN A 60 THR A 64 A 3 THR A 17 ? LEU A 22 ? THR A 17 LEU A 22 A 4 ARG A 85 ? SER A 90 ? ARG A 85 SER A 90 A 5 LYS A 81 ? VAL A 82 ? LYS A 81 VAL A 82 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 53 ? N LEU A 53 O THR A 64 ? O THR A 64 A 2 3 O VAL A 63 ? O VAL A 63 N VAL A 18 ? N VAL A 18 A 3 4 N ASN A 21 ? N ASN A 21 O LYS A 88 ? O LYS A 88 A 4 5 O ARG A 85 ? O ARG A 85 N VAL A 82 ? N VAL A 82 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A VAL 77 ? ? H A MET 80 ? ? 1.51 2 1 O A THR 39 ? ? H A GLN 43 ? ? 1.52 3 1 O A THR 26 ? ? H A LYS 30 ? ? 1.55 4 1 O A SER 73 ? ? H A VAL 77 ? ? 1.55 5 1 O A ARG 38 ? ? H A MET 42 ? ? 1.58 6 2 O A VAL 77 ? ? H A MET 80 ? ? 1.51 7 2 O A SER 73 ? ? H A VAL 77 ? ? 1.53 8 2 O A THR 26 ? ? H A LYS 30 ? ? 1.55 9 2 O A ARG 38 ? ? H A MET 42 ? ? 1.56 10 3 O A VAL 77 ? ? H A MET 80 ? ? 1.51 11 3 O A THR 26 ? ? H A LYS 30 ? ? 1.54 12 3 O A SER 3 ? ? H A GLY 7 ? ? 1.59 13 4 O A VAL 77 ? ? H A MET 80 ? ? 1.52 14 4 O A THR 39 ? ? H A GLN 43 ? ? 1.54 15 4 O A GLU 40 ? ? HG1 A THR 44 ? ? 1.55 16 5 O A THR 26 ? ? H A LYS 30 ? ? 1.55 17 5 O A ARG 38 ? ? H A MET 42 ? ? 1.57 18 5 H A VAL 19 ? ? O A SER 90 ? ? 1.59 19 6 O A VAL 77 ? ? H A MET 80 ? ? 1.49 20 6 O A THR 26 ? ? H A LYS 30 ? ? 1.53 21 6 O A THR 39 ? ? H A GLN 43 ? ? 1.53 22 7 O A VAL 77 ? ? H A MET 80 ? ? 1.55 23 7 O A SER 73 ? ? H A VAL 77 ? ? 1.55 24 7 O A MET 42 ? ? H A GLY 46 ? ? 1.60 25 8 O A VAL 77 ? ? H A MET 80 ? ? 1.53 26 8 O A THR 26 ? ? H A LYS 30 ? ? 1.58 27 9 O A VAL 77 ? ? H A MET 80 ? ? 1.50 28 10 O A THR 26 ? ? H A LYS 30 ? ? 1.50 29 10 O A VAL 77 ? ? H A MET 80 ? ? 1.55 30 11 O A ARG 38 ? ? H A MET 42 ? ? 1.52 31 11 O A VAL 77 ? ? H A MET 80 ? ? 1.53 32 11 H A VAL 19 ? ? O A SER 90 ? ? 1.57 33 12 O A VAL 77 ? ? H A MET 80 ? ? 1.49 34 12 O A SER 73 ? ? H A VAL 77 ? ? 1.52 35 13 O A VAL 77 ? ? H A MET 80 ? ? 1.48 36 13 O A ARG 38 ? ? H A MET 42 ? ? 1.49 37 13 O A THR 26 ? ? H A LYS 30 ? ? 1.55 38 14 O A VAL 77 ? ? H A MET 80 ? ? 1.51 39 14 O A ARG 38 ? ? H A MET 42 ? ? 1.60 40 15 O A VAL 77 ? ? H A MET 80 ? ? 1.55 41 15 O A THR 26 ? ? H A LYS 30 ? ? 1.55 42 16 O A VAL 77 ? ? H A MET 80 ? ? 1.50 43 16 O A THR 26 ? ? H A LYS 30 ? ? 1.51 44 17 O A VAL 77 ? ? H A MET 80 ? ? 1.50 45 17 O A ARG 38 ? ? H A MET 42 ? ? 1.54 46 17 O A THR 26 ? ? H A LYS 30 ? ? 1.57 47 18 O A SER 73 ? ? H A VAL 77 ? ? 1.50 48 18 O A VAL 77 ? ? H A MET 80 ? ? 1.57 49 18 O A ARG 38 ? ? H A MET 42 ? ? 1.58 50 19 O A VAL 77 ? ? H A MET 80 ? ? 1.49 51 20 O A VAL 77 ? ? H A MET 80 ? ? 1.49 52 20 O A THR 26 ? ? H A LYS 30 ? ? 1.51 53 20 O A ARG 38 ? ? H A MET 42 ? ? 1.52 54 20 O A GLU 28 ? ? H A GLU 32 ? ? 1.54 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 10 ? ? 45.92 94.74 2 1 GLN A 11 ? ? -171.80 107.82 3 1 ALA A 16 ? ? 71.22 43.41 4 1 GLU A 32 ? ? -174.32 132.13 5 1 PHE A 33 ? ? -39.02 132.50 6 1 ARG A 38 ? ? -38.38 -75.22 7 1 MET A 61 ? ? -151.78 89.94 8 1 MET A 80 ? ? -45.06 169.93 9 1 SER A 94 ? ? -168.33 116.42 10 2 SER A 8 ? ? 62.39 87.05 11 2 PHE A 10 ? ? 50.13 100.56 12 2 GLN A 11 ? ? -140.43 -52.90 13 2 ALA A 16 ? ? 81.68 36.41 14 2 ARG A 38 ? ? -39.21 -75.19 15 2 LEU A 53 ? ? 174.26 149.07 16 2 GLN A 58 ? ? -26.07 -47.14 17 2 SER A 93 ? ? 72.55 155.30 18 3 SER A 2 ? ? -119.34 75.25 19 3 SER A 3 ? ? -96.41 -61.35 20 3 PHE A 10 ? ? 51.95 175.18 21 3 GLN A 11 ? ? 59.50 86.51 22 3 ALA A 16 ? ? 80.85 38.72 23 3 ARG A 38 ? ? -41.18 -73.12 24 3 TYR A 48 ? ? -37.77 -38.70 25 3 LEU A 53 ? ? 173.48 148.32 26 3 GLN A 60 ? ? 179.73 -173.33 27 3 MET A 61 ? ? -167.62 103.34 28 3 SER A 94 ? ? 67.14 86.00 29 4 SER A 9 ? ? -96.74 -62.13 30 4 PHE A 10 ? ? 40.40 74.62 31 4 GLN A 11 ? ? -173.80 138.54 32 4 ALA A 16 ? ? 79.59 37.76 33 4 GLU A 32 ? ? -175.46 139.75 34 4 ARG A 38 ? ? -66.58 -75.45 35 4 THR A 44 ? ? -67.19 -71.51 36 4 ILE A 51 ? ? -63.28 94.20 37 4 GLN A 58 ? ? -26.14 -51.38 38 4 MET A 80 ? ? -49.92 173.18 39 4 PRO A 92 ? ? -74.97 -165.69 40 4 SER A 94 ? ? 56.99 162.69 41 5 SER A 8 ? ? -169.78 95.04 42 5 PHE A 10 ? ? -168.15 -42.52 43 5 ALA A 16 ? ? 71.26 57.27 44 5 ARG A 38 ? ? -37.31 -75.42 45 5 ILE A 51 ? ? -61.86 97.22 46 5 LEU A 53 ? ? 174.13 152.84 47 5 GLN A 58 ? ? -22.93 -51.98 48 5 MET A 80 ? ? -40.34 160.04 49 6 SER A 2 ? ? 178.44 -58.05 50 6 SER A 8 ? ? -178.63 115.96 51 6 PHE A 10 ? ? -171.89 143.85 52 6 LEU A 14 ? ? -93.74 -63.97 53 6 GLU A 32 ? ? 178.51 135.60 54 6 ARG A 38 ? ? -37.63 -75.46 55 6 THR A 44 ? ? -76.09 -74.06 56 6 ILE A 51 ? ? -64.11 97.93 57 6 GLN A 58 ? ? -20.93 -54.74 58 6 MET A 80 ? ? -49.83 164.28 59 6 PRO A 92 ? ? -74.98 -84.10 60 7 SER A 2 ? ? -178.57 91.53 61 7 SER A 8 ? ? 57.98 84.80 62 7 PHE A 10 ? ? 58.53 109.14 63 7 GLN A 11 ? ? 62.54 133.47 64 7 ALA A 16 ? ? 71.08 48.40 65 7 THR A 26 ? ? -113.79 -160.84 66 7 GLU A 32 ? ? 177.77 137.91 67 7 THR A 44 ? ? -59.71 -71.94 68 7 LEU A 53 ? ? 178.04 149.21 69 7 GLN A 58 ? ? -29.56 -42.25 70 7 MET A 80 ? ? -39.55 160.18 71 8 GLN A 11 ? ? -163.18 115.37 72 8 ALA A 16 ? ? 75.15 72.54 73 8 ARG A 38 ? ? -42.53 -74.37 74 8 LEU A 53 ? ? 178.11 149.80 75 8 GLN A 58 ? ? -29.83 -42.68 76 8 MET A 80 ? ? -38.94 140.29 77 9 SER A 8 ? ? 49.87 93.43 78 9 PHE A 10 ? ? -177.26 120.73 79 9 GLU A 32 ? ? -173.59 144.36 80 9 ARG A 38 ? ? -58.30 -75.24 81 9 GLN A 58 ? ? -19.12 -56.62 82 9 MET A 80 ? ? -52.69 173.21 83 9 SER A 93 ? ? -124.82 -67.66 84 10 SER A 8 ? ? 47.79 79.48 85 10 PHE A 10 ? ? 53.20 173.38 86 10 ALA A 16 ? ? 74.93 43.76 87 10 GLU A 32 ? ? -177.98 135.71 88 10 ARG A 38 ? ? -41.68 -75.61 89 10 LEU A 53 ? ? -176.11 148.49 90 10 GLN A 58 ? ? -29.72 -44.76 91 10 GLN A 60 ? ? -172.25 -175.18 92 10 ASP A 78 ? ? -36.80 -37.26 93 10 LYS A 83 ? ? 63.29 -68.49 94 10 SER A 93 ? ? 61.88 76.40 95 10 SER A 94 ? ? -59.31 109.00 96 11 SER A 8 ? ? 57.39 79.59 97 11 SER A 9 ? ? -91.86 -61.53 98 11 PHE A 10 ? ? 48.10 97.75 99 11 ILE A 51 ? ? -58.75 98.79 100 11 LEU A 53 ? ? 177.57 157.04 101 11 GLN A 58 ? ? -27.17 -46.54 102 11 SER A 93 ? ? 46.81 90.70 103 12 SER A 8 ? ? -116.83 77.05 104 12 PHE A 10 ? ? -120.88 -55.39 105 12 GLN A 11 ? ? -177.78 -58.35 106 12 ASP A 15 ? ? -90.14 -64.43 107 12 ALA A 16 ? ? 175.07 41.36 108 12 THR A 44 ? ? -68.17 -71.78 109 12 GLN A 58 ? ? -17.66 -57.92 110 12 MET A 80 ? ? -50.85 176.91 111 13 SER A 8 ? ? 53.25 88.28 112 13 PHE A 10 ? ? 48.22 94.67 113 13 ALA A 16 ? ? 78.25 44.21 114 13 LEU A 37 ? ? -94.89 -60.26 115 13 LEU A 53 ? ? 171.04 148.89 116 13 GLN A 58 ? ? -24.20 -57.14 117 13 MET A 80 ? ? -38.60 151.22 118 13 SER A 93 ? ? 165.83 -45.02 119 13 SER A 94 ? ? 169.61 72.49 120 14 SER A 2 ? ? 41.40 81.78 121 14 SER A 8 ? ? 51.25 83.31 122 14 PHE A 10 ? ? 38.10 91.51 123 14 GLN A 11 ? ? 58.28 162.71 124 14 ALA A 16 ? ? 176.53 42.72 125 14 GLU A 32 ? ? -177.24 140.21 126 14 ARG A 38 ? ? -43.76 -73.40 127 14 TYR A 48 ? ? -43.20 -76.96 128 14 ILE A 51 ? ? -59.41 97.10 129 14 LEU A 53 ? ? 171.19 151.92 130 14 GLN A 58 ? ? -18.97 -56.35 131 14 MET A 80 ? ? -39.84 150.52 132 14 SER A 90 ? ? -116.23 -165.37 133 14 SER A 93 ? ? 69.25 -72.16 134 15 SER A 2 ? ? 59.52 108.92 135 15 SER A 8 ? ? -157.68 79.62 136 15 PHE A 10 ? ? -154.45 -55.52 137 15 GLN A 11 ? ? 39.68 80.40 138 15 ALA A 16 ? ? 76.49 41.47 139 15 ARG A 38 ? ? -37.91 -74.85 140 15 LEU A 53 ? ? 178.27 154.39 141 15 GLN A 58 ? ? -21.54 -52.93 142 15 ASP A 78 ? ? -34.94 -36.06 143 15 MET A 80 ? ? -44.63 170.32 144 15 SER A 94 ? ? -165.30 85.93 145 16 SER A 8 ? ? 56.32 85.90 146 16 PHE A 10 ? ? 41.85 93.11 147 16 GLN A 11 ? ? -107.46 78.89 148 16 ALA A 16 ? ? 80.79 41.64 149 16 GLU A 32 ? ? -178.42 145.35 150 16 LEU A 53 ? ? 173.40 142.39 151 16 GLN A 60 ? ? 179.60 -171.84 152 16 MET A 80 ? ? -45.59 172.56 153 16 SER A 93 ? ? -176.71 -62.58 154 16 SER A 94 ? ? 174.65 82.27 155 17 SER A 2 ? ? -166.58 96.61 156 17 SER A 8 ? ? 39.83 84.28 157 17 SER A 9 ? ? -96.44 -61.25 158 17 PHE A 10 ? ? 50.86 101.06 159 17 LEU A 14 ? ? -93.47 -65.32 160 17 GLU A 32 ? ? -178.20 136.85 161 17 LEU A 37 ? ? -95.49 -60.23 162 17 LEU A 53 ? ? -174.43 130.01 163 17 GLN A 58 ? ? -28.35 -44.31 164 17 MET A 80 ? ? -45.53 167.75 165 17 SER A 93 ? ? 60.50 70.04 166 17 SER A 94 ? ? -154.45 -56.75 167 18 SER A 8 ? ? 59.63 78.48 168 18 ALA A 16 ? ? 83.89 31.15 169 18 PRO A 25 ? ? -75.03 -168.91 170 18 PHE A 33 ? ? -37.87 140.23 171 18 LEU A 37 ? ? -95.49 -62.20 172 18 LEU A 53 ? ? -172.92 141.11 173 18 GLN A 58 ? ? -26.79 -46.83 174 18 PRO A 92 ? ? -75.07 -165.10 175 19 SER A 2 ? ? 40.85 89.06 176 19 SER A 8 ? ? 62.30 82.26 177 19 PHE A 10 ? ? 54.34 94.70 178 19 GLN A 11 ? ? 175.17 166.24 179 19 LEU A 14 ? ? -94.11 -69.61 180 19 ALA A 16 ? ? 174.20 40.32 181 19 THR A 26 ? ? -87.69 -156.87 182 19 GLU A 32 ? ? -176.26 126.35 183 19 THR A 50 ? ? -151.01 19.22 184 19 ILE A 51 ? ? 36.08 89.12 185 19 LEU A 53 ? ? 177.48 152.79 186 19 GLN A 58 ? ? -21.38 -54.47 187 19 SER A 93 ? ? -177.84 -172.24 188 20 PHE A 10 ? ? 52.72 88.07 189 20 GLN A 11 ? ? 179.46 98.24 190 20 ALA A 16 ? ? 64.85 71.13 191 20 THR A 26 ? ? -102.18 -168.55 192 20 GLU A 32 ? ? -177.88 133.69 193 20 PHE A 33 ? ? -37.72 136.78 194 20 ARG A 38 ? ? -38.22 -75.82 195 20 LEU A 53 ? ? 179.71 148.75 196 20 GLN A 58 ? ? -26.73 -46.96 197 20 SER A 70 ? ? -57.90 -71.82 198 20 ALA A 71 ? ? -38.45 -38.50 199 20 MET A 80 ? ? -44.42 168.93 200 20 SER A 94 ? ? -161.74 -44.30 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX determination method: author determined ; # _pdbx_nmr_ensemble.entry_id 1UFW _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1UFW _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.1mM RNP domain U-15N, 13C; 20mM phosphate buffer NA(pH 6.0); 100mM NaCl; 0.02% NaN3; 90% H2O, 10% D2O;' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_13C-separated_NOESY # _pdbx_nmr_refine.entry_id 1UFW _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 NMRPipe 20020425 processing 'Delaglio, F.' 2 NMRView 5.0.4 'data analysis' 'Johnson, B.A.' 3 KUJIRA 0.811 'data analysis' 'Kobayashi, N.' 4 CYANA 1.0.7 'structure solution' 'Guentert, P.' 5 CYANA 1.0.7 refinement 'Guentert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 # _atom_sites.entry_id 1UFW _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_