data_1URU # _entry.id 1URU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.315 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1URU PDBE EBI-13907 WWPDB D_1290013907 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1URU _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2003-11-06 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Evans, P.R.' 1 'Kent, H.M.' 2 # _citation.id primary _citation.title 'Bar Domains as Sensors of Membrane Curvature: The Amphiphysin Bar Structure' _citation.journal_abbrev Science _citation.journal_volume 303 _citation.page_first 495 _citation.page_last ? _citation.year 2004 _citation.journal_id_ASTM SCIEAS _citation.country US _citation.journal_id_ISSN 0036-8075 _citation.journal_id_CSD 0038 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 14645856 _citation.pdbx_database_id_DOI 10.1126/SCIENCE.1092586 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Peter, B.J.' 1 ? primary 'Kent, H.M.' 2 ? primary 'Mills, I.G.' 3 ? primary 'Vallis, Y.' 4 ? primary 'Butler, J.G.' 5 ? primary 'Evans, P.R.' 6 ? primary 'Mcmahon, H.T.' 7 ? # _cell.entry_id 1URU _cell.length_a 49.586 _cell.length_b 49.586 _cell.length_c 190.319 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1URU _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man AMPHIPHYSIN 28269.152 1 ? ? 'BAR DOMAIN, RESIDUES 1-244' 'SEMET SUBSTITUTED' 2 water nat water 18.015 37 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)TENKGI(MSE)LAKSVQKHAGRAKEKILQNLGKVDRTADEIFDDHLNNFNRQQASANRLQKEFNNYIRCVRAAQA ASKTL(MSE)DSVCEIYEPQWSGYDALQAQTGASESLWADFAHKLGDQVLIPLNTYTGQFPE(MSE)KKKVEKRNRKLID YDGQRHSFQNLQANANKRKDDVKLTKGREQLEEARRTYEILNTELHDELPALYDSRILFLVTNLQTLFATEQVFHNETAK IYSELEAIVDKLATESQRGS ; _entity_poly.pdbx_seq_one_letter_code_can ;MTENKGIMLAKSVQKHAGRAKEKILQNLGKVDRTADEIFDDHLNNFNRQQASANRLQKEFNNYIRCVRAAQAASKTLMDS VCEIYEPQWSGYDALQAQTGASESLWADFAHKLGDQVLIPLNTYTGQFPEMKKKVEKRNRKLIDYDGQRHSFQNLQANAN KRKDDVKLTKGREQLEEARRTYEILNTELHDELPALYDSRILFLVTNLQTLFATEQVFHNETAKIYSELEAIVDKLATES QRGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 THR n 1 3 GLU n 1 4 ASN n 1 5 LYS n 1 6 GLY n 1 7 ILE n 1 8 MSE n 1 9 LEU n 1 10 ALA n 1 11 LYS n 1 12 SER n 1 13 VAL n 1 14 GLN n 1 15 LYS n 1 16 HIS n 1 17 ALA n 1 18 GLY n 1 19 ARG n 1 20 ALA n 1 21 LYS n 1 22 GLU n 1 23 LYS n 1 24 ILE n 1 25 LEU n 1 26 GLN n 1 27 ASN n 1 28 LEU n 1 29 GLY n 1 30 LYS n 1 31 VAL n 1 32 ASP n 1 33 ARG n 1 34 THR n 1 35 ALA n 1 36 ASP n 1 37 GLU n 1 38 ILE n 1 39 PHE n 1 40 ASP n 1 41 ASP n 1 42 HIS n 1 43 LEU n 1 44 ASN n 1 45 ASN n 1 46 PHE n 1 47 ASN n 1 48 ARG n 1 49 GLN n 1 50 GLN n 1 51 ALA n 1 52 SER n 1 53 ALA n 1 54 ASN n 1 55 ARG n 1 56 LEU n 1 57 GLN n 1 58 LYS n 1 59 GLU n 1 60 PHE n 1 61 ASN n 1 62 ASN n 1 63 TYR n 1 64 ILE n 1 65 ARG n 1 66 CYS n 1 67 VAL n 1 68 ARG n 1 69 ALA n 1 70 ALA n 1 71 GLN n 1 72 ALA n 1 73 ALA n 1 74 SER n 1 75 LYS n 1 76 THR n 1 77 LEU n 1 78 MSE n 1 79 ASP n 1 80 SER n 1 81 VAL n 1 82 CYS n 1 83 GLU n 1 84 ILE n 1 85 TYR n 1 86 GLU n 1 87 PRO n 1 88 GLN n 1 89 TRP n 1 90 SER n 1 91 GLY n 1 92 TYR n 1 93 ASP n 1 94 ALA n 1 95 LEU n 1 96 GLN n 1 97 ALA n 1 98 GLN n 1 99 THR n 1 100 GLY n 1 101 ALA n 1 102 SER n 1 103 GLU n 1 104 SER n 1 105 LEU n 1 106 TRP n 1 107 ALA n 1 108 ASP n 1 109 PHE n 1 110 ALA n 1 111 HIS n 1 112 LYS n 1 113 LEU n 1 114 GLY n 1 115 ASP n 1 116 GLN n 1 117 VAL n 1 118 LEU n 1 119 ILE n 1 120 PRO n 1 121 LEU n 1 122 ASN n 1 123 THR n 1 124 TYR n 1 125 THR n 1 126 GLY n 1 127 GLN n 1 128 PHE n 1 129 PRO n 1 130 GLU n 1 131 MSE n 1 132 LYS n 1 133 LYS n 1 134 LYS n 1 135 VAL n 1 136 GLU n 1 137 LYS n 1 138 ARG n 1 139 ASN n 1 140 ARG n 1 141 LYS n 1 142 LEU n 1 143 ILE n 1 144 ASP n 1 145 TYR n 1 146 ASP n 1 147 GLY n 1 148 GLN n 1 149 ARG n 1 150 HIS n 1 151 SER n 1 152 PHE n 1 153 GLN n 1 154 ASN n 1 155 LEU n 1 156 GLN n 1 157 ALA n 1 158 ASN n 1 159 ALA n 1 160 ASN n 1 161 LYS n 1 162 ARG n 1 163 LYS n 1 164 ASP n 1 165 ASP n 1 166 VAL n 1 167 LYS n 1 168 LEU n 1 169 THR n 1 170 LYS n 1 171 GLY n 1 172 ARG n 1 173 GLU n 1 174 GLN n 1 175 LEU n 1 176 GLU n 1 177 GLU n 1 178 ALA n 1 179 ARG n 1 180 ARG n 1 181 THR n 1 182 TYR n 1 183 GLU n 1 184 ILE n 1 185 LEU n 1 186 ASN n 1 187 THR n 1 188 GLU n 1 189 LEU n 1 190 HIS n 1 191 ASP n 1 192 GLU n 1 193 LEU n 1 194 PRO n 1 195 ALA n 1 196 LEU n 1 197 TYR n 1 198 ASP n 1 199 SER n 1 200 ARG n 1 201 ILE n 1 202 LEU n 1 203 PHE n 1 204 LEU n 1 205 VAL n 1 206 THR n 1 207 ASN n 1 208 LEU n 1 209 GLN n 1 210 THR n 1 211 LEU n 1 212 PHE n 1 213 ALA n 1 214 THR n 1 215 GLU n 1 216 GLN n 1 217 VAL n 1 218 PHE n 1 219 HIS n 1 220 ASN n 1 221 GLU n 1 222 THR n 1 223 ALA n 1 224 LYS n 1 225 ILE n 1 226 TYR n 1 227 SER n 1 228 GLU n 1 229 LEU n 1 230 GLU n 1 231 ALA n 1 232 ILE n 1 233 VAL n 1 234 ASP n 1 235 LYS n 1 236 LEU n 1 237 ALA n 1 238 THR n 1 239 GLU n 1 240 SER n 1 241 GLN n 1 242 ARG n 1 243 GLY n 1 244 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'FRUIT FLY' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'DROSOPHILA MELANOGASTER' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7227 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PGEX _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PGEX _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'GROWN IN MINIMAL MEDIUM + SEMET' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9Y092 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q9Y092 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1URU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 244 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y092 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 244 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 244 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1URU _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.39 _exptl_crystal.density_percent_sol 51.1 _exptl_crystal.description ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.00 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;2.5MG/ML PROTEIN SOLUTION IN 18% PEG4000, 200MM NACL, 1MM DTT, 20MM HEPES PH 7.4 MIXED WITH THE WELL SOLUTION 18% PEG 4000, 0.2M AMMONIUM ACETATE, 100MM SODIUM CITRATE PH 6.0. CRYSTALS WERE EQUILIBRATED IN 20% GLYCEROL FOR COOLING TO 100K. ; # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date 2001-11-15 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_wavelength 0.979 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 1URU _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 31.940 _reflns.d_resolution_high 2.600 _reflns.number_obs 8657 _reflns.number_all ? _reflns.percent_possible_obs 97.2 _reflns.pdbx_Rmerge_I_obs 0.13400 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 4.9102 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 10.210 _reflns.pdbx_CC_half ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_Rrim_I_all ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.60 _reflns_shell.d_res_low 2.74 _reflns_shell.percent_possible_all 86.0 _reflns_shell.Rmerge_I_obs 1.010 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 0.730 _reflns_shell.pdbx_redundancy 9.29 _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 1URU _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 7786 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 63.25 _refine.ls_d_res_high 2.60 _refine.ls_percent_reflns_obs 97.21 _refine.ls_R_factor_obs 0.23405 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.23649 _refine.ls_R_factor_R_free 0.30636 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.0 _refine.ls_number_reflns_R_free 867 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 55.997 _refine.aniso_B[1][1] 3.03 _refine.aniso_B[2][2] 3.03 _refine.aniso_B[3][3] -4.55 _refine.aniso_B[1][2] 1.52 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct OTHER _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 1.164 _refine.pdbx_overall_ESU_R_Free 0.402 _refine.overall_SU_ML 0.283 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 13.987 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1771 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 37 _refine_hist.number_atoms_total 1808 _refine_hist.d_res_high 2.60 _refine_hist.d_res_low 63.25 # _struct.entry_id 1URU _struct.title 'Amphiphysin BAR domain from Drosophila' _struct.pdbx_descriptor AMPHIPHYSIN _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1URU _struct_keywords.pdbx_keywords ENDOCYTOSIS _struct_keywords.text 'ENDOCYTOSIS, COILED-COIL, MEMBRANE CURVATURE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 34 ? TYR A 85 ? THR A 34 TYR A 85 1 ? 52 HELX_P HELX_P2 2 GLY A 91 ? ASP A 115 ? GLY A 91 ASP A 115 1 ? 25 HELX_P HELX_P3 3 VAL A 117 ? GLN A 127 ? VAL A 117 GLN A 127 1 ? 11 HELX_P HELX_P4 4 LYS A 132 ? ALA A 157 ? LYS A 132 ALA A 157 1 ? 26 HELX_P HELX_P5 5 GLY A 171 ? SER A 240 ? GLY A 171 SER A 240 1 ? 70 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A LEU 77 C ? ? ? 1_555 A MSE 78 N ? ? A LEU 77 A MSE 78 1_555 ? ? ? ? ? ? ? 1.321 ? covale2 covale both ? A MSE 78 C ? ? ? 1_555 A ASP 79 N ? ? A MSE 78 A ASP 79 1_555 ? ? ? ? ? ? ? 1.326 ? covale3 covale both ? A GLU 130 C ? ? ? 1_555 A MSE 131 N ? ? A GLU 130 A MSE 131 1_555 ? ? ? ? ? ? ? 1.329 ? covale4 covale both ? A MSE 131 C ? ? ? 1_555 A LYS 132 N ? ? A MSE 131 A LYS 132 1_555 ? ? ? ? ? ? ? 1.327 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1URU _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1URU _atom_sites.fract_transf_matrix[1][1] 0.020167 _atom_sites.fract_transf_matrix[1][2] 0.011643 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023287 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005254 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 ASN 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 GLY 6 6 ? ? ? A . n A 1 7 ILE 7 7 ? ? ? A . n A 1 8 MSE 8 8 ? ? ? A . n A 1 9 LEU 9 9 ? ? ? A . n A 1 10 ALA 10 10 ? ? ? A . n A 1 11 LYS 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 VAL 13 13 ? ? ? A . n A 1 14 GLN 14 14 ? ? ? A . n A 1 15 LYS 15 15 ? ? ? A . n A 1 16 HIS 16 16 ? ? ? A . n A 1 17 ALA 17 17 ? ? ? A . n A 1 18 GLY 18 18 ? ? ? A . n A 1 19 ARG 19 19 ? ? ? A . n A 1 20 ALA 20 20 ? ? ? A . n A 1 21 LYS 21 21 ? ? ? A . n A 1 22 GLU 22 22 ? ? ? A . n A 1 23 LYS 23 23 ? ? ? A . n A 1 24 ILE 24 24 ? ? ? A . n A 1 25 LEU 25 25 ? ? ? A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 MSE 78 78 78 MSE MSE A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 CYS 82 82 82 CYS CYS A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 TRP 89 89 89 TRP TRP A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 TRP 106 106 106 TRP TRP A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 HIS 111 111 111 HIS HIS A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 MSE 131 131 131 MSE MSE A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 TYR 145 145 145 TYR TYR A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 GLN 148 148 148 GLN GLN A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 HIS 150 150 150 HIS HIS A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 PHE 152 152 152 PHE PHE A . n A 1 153 GLN 153 153 153 GLN GLN A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 GLN 156 156 156 GLN GLN A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 ASN 158 158 158 ASN ASN A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 ASN 160 160 160 ASN ASN A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 THR 169 169 169 THR THR A . n A 1 170 LYS 170 170 170 LYS LYS A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 ARG 179 179 179 ARG ARG A . n A 1 180 ARG 180 180 180 ARG ARG A . n A 1 181 THR 181 181 181 THR THR A . n A 1 182 TYR 182 182 182 TYR TYR A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 ILE 184 184 184 ILE ILE A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 ASN 186 186 186 ASN ASN A . n A 1 187 THR 187 187 187 THR THR A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 HIS 190 190 190 HIS HIS A . n A 1 191 ASP 191 191 191 ASP ASP A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 PRO 194 194 194 PRO PRO A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 TYR 197 197 197 TYR TYR A . n A 1 198 ASP 198 198 198 ASP ASP A . n A 1 199 SER 199 199 199 SER SER A . n A 1 200 ARG 200 200 200 ARG ARG A . n A 1 201 ILE 201 201 201 ILE ILE A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 PHE 203 203 203 PHE PHE A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 THR 206 206 206 THR THR A . n A 1 207 ASN 207 207 207 ASN ASN A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 GLN 209 209 209 GLN GLN A . n A 1 210 THR 210 210 210 THR THR A . n A 1 211 LEU 211 211 211 LEU LEU A . n A 1 212 PHE 212 212 212 PHE PHE A . n A 1 213 ALA 213 213 213 ALA ALA A . n A 1 214 THR 214 214 214 THR THR A . n A 1 215 GLU 215 215 215 GLU GLU A . n A 1 216 GLN 216 216 216 GLN GLN A . n A 1 217 VAL 217 217 217 VAL VAL A . n A 1 218 PHE 218 218 218 PHE PHE A . n A 1 219 HIS 219 219 219 HIS HIS A . n A 1 220 ASN 220 220 220 ASN ASN A . n A 1 221 GLU 221 221 221 GLU GLU A . n A 1 222 THR 222 222 222 THR THR A . n A 1 223 ALA 223 223 223 ALA ALA A . n A 1 224 LYS 224 224 224 LYS LYS A . n A 1 225 ILE 225 225 225 ILE ILE A . n A 1 226 TYR 226 226 226 TYR TYR A . n A 1 227 SER 227 227 227 SER SER A . n A 1 228 GLU 228 228 228 GLU GLU A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 GLU 230 230 230 GLU GLU A . n A 1 231 ALA 231 231 231 ALA ALA A . n A 1 232 ILE 232 232 232 ILE ILE A . n A 1 233 VAL 233 233 233 VAL VAL A . n A 1 234 ASP 234 234 234 ASP ASP A . n A 1 235 LYS 235 235 235 LYS LYS A . n A 1 236 LEU 236 236 236 LEU LEU A . n A 1 237 ALA 237 237 237 ALA ALA A . n A 1 238 THR 238 238 238 THR THR A . n A 1 239 GLU 239 239 239 GLU GLU A . n A 1 240 SER 240 240 240 SER SER A . n A 1 241 GLN 241 241 241 GLN GLN A . n A 1 242 ARG 242 242 242 ARG ARG A . n A 1 243 GLY 243 243 ? ? ? A . n A 1 244 SER 244 244 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 2001 2001 HOH HOH A . B 2 HOH 2 2002 2002 HOH HOH A . B 2 HOH 3 2003 2003 HOH HOH A . B 2 HOH 4 2004 2004 HOH HOH A . B 2 HOH 5 2005 2005 HOH HOH A . B 2 HOH 6 2006 2006 HOH HOH A . B 2 HOH 7 2007 2007 HOH HOH A . B 2 HOH 8 2008 2008 HOH HOH A . B 2 HOH 9 2009 2009 HOH HOH A . B 2 HOH 10 2010 2010 HOH HOH A . B 2 HOH 11 2011 2011 HOH HOH A . B 2 HOH 12 2012 2012 HOH HOH A . B 2 HOH 13 2013 2013 HOH HOH A . B 2 HOH 14 2014 2014 HOH HOH A . B 2 HOH 15 2015 2015 HOH HOH A . B 2 HOH 16 2016 2016 HOH HOH A . B 2 HOH 17 2017 2017 HOH HOH A . B 2 HOH 18 2018 2018 HOH HOH A . B 2 HOH 19 2019 2019 HOH HOH A . B 2 HOH 20 2020 2020 HOH HOH A . B 2 HOH 21 2021 2021 HOH HOH A . B 2 HOH 22 2022 2022 HOH HOH A . B 2 HOH 23 2023 2023 HOH HOH A . B 2 HOH 24 2024 2024 HOH HOH A . B 2 HOH 25 2025 2025 HOH HOH A . B 2 HOH 26 2026 2026 HOH HOH A . B 2 HOH 27 2027 2027 HOH HOH A . B 2 HOH 28 2028 2028 HOH HOH A . B 2 HOH 29 2029 2029 HOH HOH A . B 2 HOH 30 2030 2030 HOH HOH A . B 2 HOH 31 2031 2031 HOH HOH A . B 2 HOH 32 2032 2032 HOH HOH A . B 2 HOH 33 2033 2033 HOH HOH A . B 2 HOH 34 2034 2034 HOH HOH A . B 2 HOH 35 2035 2035 HOH HOH A . B 2 HOH 36 2036 2036 HOH HOH A . B 2 HOH 37 2037 2037 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 78 A MSE 78 ? MET SELENOMETHIONINE 2 A MSE 131 A MSE 131 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 -x,-x+y,-z+1/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 63.4396666667 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 2008 ? B HOH . 2 1 A HOH 2017 ? B HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-12-04 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2019-10-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Experimental preparation' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' exptl_crystal_grow 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_special_symmetry 4 4 'Structure model' reflns_shell 5 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_exptl_crystal_grow.method' 2 4 'Structure model' '_pdbx_database_status.status_code_sf' 3 4 'Structure model' '_reflns_shell.Rmerge_I_obs' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language REFMAC refinement . ? 1 ? ? ? ? MOSFLM 'data reduction' . ? 2 ? ? ? ? SCALA 'data scaling' . ? 3 ? ? ? ? SHARP phasing . ? 4 ? ? ? ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 32 ? ? CG A ASP 32 ? ? OD2 A ASP 32 ? ? 126.35 118.30 8.05 0.90 N 2 1 CB A ASP 144 ? ? CG A ASP 144 ? ? OD2 A ASP 144 ? ? 124.26 118.30 5.96 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 27 ? ? -159.53 -159.38 2 1 LYS A 30 ? ? -54.24 103.00 3 1 ASP A 115 ? ? -122.46 -77.69 4 1 ALA A 157 ? ? -73.11 -73.45 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 LYS _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 170 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 GLY _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 171 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 146.47 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A ASN 4 ? A ASN 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A GLY 6 ? A GLY 6 7 1 Y 1 A ILE 7 ? A ILE 7 8 1 Y 1 A MSE 8 ? A MSE 8 9 1 Y 1 A LEU 9 ? A LEU 9 10 1 Y 1 A ALA 10 ? A ALA 10 11 1 Y 1 A LYS 11 ? A LYS 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A VAL 13 ? A VAL 13 14 1 Y 1 A GLN 14 ? A GLN 14 15 1 Y 1 A LYS 15 ? A LYS 15 16 1 Y 1 A HIS 16 ? A HIS 16 17 1 Y 1 A ALA 17 ? A ALA 17 18 1 Y 1 A GLY 18 ? A GLY 18 19 1 Y 1 A ARG 19 ? A ARG 19 20 1 Y 1 A ALA 20 ? A ALA 20 21 1 Y 1 A LYS 21 ? A LYS 21 22 1 Y 1 A GLU 22 ? A GLU 22 23 1 Y 1 A LYS 23 ? A LYS 23 24 1 Y 1 A ILE 24 ? A ILE 24 25 1 Y 1 A LEU 25 ? A LEU 25 26 1 Y 1 A GLY 243 ? A GLY 243 27 1 Y 1 A SER 244 ? A SER 244 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #