data_1VTP # _entry.id 1VTP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1VTP pdb_00001vtp 10.2210/pdb1vtp/pdb WWPDB D_1000177120 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-03-08 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1VTP _pdbx_database_status.recvd_initial_deposition_date 1995-11-14 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nielsen, K.J.' 1 'Hill, J.M.' 2 'Anderson, M.A.' 3 'Craik, D.J.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Synthesis and structure determination by NMR of a putative vacuolar targeting peptide and model of a proteinase inhibitor from Nicotiana alata. ; Biochemistry 35 369 378 1996 BICHAW US 0006-2960 0033 ? 8555206 10.1021/bi952228i 1 'Structures of a Series of 6-kDa Trypsin Inhibitors Isolated from the Stigma of Nicotiana Alata' Biochemistry 34 14304 ? 1995 BICHAW US 0006-2960 0033 ? ? ? 2 'The Three-Dimensional Solution Structure by 1H NMR of a 6-Kd Proteinase Inhibitor from the Stigmas of Nicotiana Alata' J.Mol.Biol. 242 231 ? 1994 JMOBAK UK 0022-2836 0070 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nielsen, K.J.' 1 ? primary 'Hill, J.M.' 2 ? primary 'Anderson, M.A.' 3 ? primary 'Craik, D.J.' 4 ? 1 'Nielsen, K.J.' 5 ? 1 'Heath, R.L.' 6 ? 1 'Anderson, M.A.' 7 ? 1 'Craik, D.J.' 8 ? 2 'Nielsen, K.J.' 9 ? 2 'Heath, R.L.' 10 ? 2 'Anderson, M.A.' 11 ? 2 'Craik, D.J.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'VACUOLAR TARGETING PEPTIDE' _entity.formula_weight 2877.095 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'C-TERMINAL RESIDUES 29 - 54' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name NA-PROPI # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SEYASKVDEYVGEVENDLQKSKVAVS _entity_poly.pdbx_seq_one_letter_code_can SEYASKVDEYVGEVENDLQKSKVAVS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLU n 1 3 TYR n 1 4 ALA n 1 5 SER n 1 6 LYS n 1 7 VAL n 1 8 ASP n 1 9 GLU n 1 10 TYR n 1 11 VAL n 1 12 GLY n 1 13 GLU n 1 14 VAL n 1 15 GLU n 1 16 ASN n 1 17 ASP n 1 18 LEU n 1 19 GLN n 1 20 LYS n 1 21 SER n 1 22 LYS n 1 23 VAL n 1 24 ALA n 1 25 VAL n 1 26 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Persian tobacco' _entity_src_gen.gene_src_genus Nicotiana _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Nicotiana alata' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4087 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ STIGMA _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 SER 26 26 26 SER SER A . n # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # _cell.entry_id 1VTP _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1VTP _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1VTP _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1VTP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1VTP _struct.title 'VACUOLAR TARGETING PEPTIDE FROM NA-PROPI' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1VTP _struct_keywords.pdbx_keywords 'TARGETING PEPTIDE' _struct_keywords.text 'NICOTIANA ALATA PROTEINASE INHIBITORS, TARGETING PEPTIDE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q40378_NICAL _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q40378 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MAAHRVSFLALLLLFGMSLLVSNVEHADAKACTLNCDPRIAYGVCPRSEEKKNDRICTNCCAGTKGCKYFSDDGTFVCEG ESDPRNPKACTLNCDPRIAYGVCPRSEEKKNDRICTNCCAGTKGCKYFSDDGTFVCEGESDPKNPKACPRNCDPRIAYGI CPLSEEKKNDRICTNCCAGKKGCKYFSDDGTFVCEGESDPRNPKACPRNCDGRIAYGICPLSEEKKNDRICTNCCAGKKG CKYFSDDGTFICEGESEYASKVDEYVGEVENDLQKSKVAVS ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1VTP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 26 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q40378 _struct_ref_seq.db_align_beg 256 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 281 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 26 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id A _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 4 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 23 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 4 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 23 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 2 ? ? -85.75 36.33 2 1 ALA A 4 ? ? -155.36 8.18 3 1 SER A 5 ? ? -106.37 -64.88 4 1 VAL A 25 ? ? 64.81 162.08 5 2 TYR A 3 ? ? -89.70 41.90 6 2 ALA A 4 ? ? -81.41 46.05 7 2 SER A 5 ? ? -148.33 -62.64 8 2 LYS A 22 ? ? -87.31 39.24 9 4 ALA A 4 ? ? 58.69 16.57 10 4 SER A 5 ? ? -140.66 -79.13 11 4 VAL A 11 ? ? -38.73 -27.22 12 4 LYS A 22 ? ? -37.96 -32.61 13 4 ALA A 24 ? ? -163.77 14.94 14 5 ALA A 4 ? ? -146.03 -78.00 15 5 VAL A 23 ? ? -83.51 36.86 16 5 ALA A 24 ? ? -172.29 107.99 17 5 VAL A 25 ? ? 57.49 -180.00 18 6 TYR A 3 ? ? -55.21 176.62 19 6 ALA A 4 ? ? 70.04 111.47 20 6 SER A 5 ? ? 82.02 -60.86 21 6 VAL A 23 ? ? -86.96 34.92 22 6 ALA A 24 ? ? -168.40 69.30 23 7 ALA A 4 ? ? -132.00 -39.38 24 7 ALA A 24 ? ? -131.05 -68.36 25 8 SER A 5 ? ? 77.90 -60.97 26 8 VAL A 11 ? ? -34.33 -28.99 27 8 LYS A 22 ? ? -93.67 30.98 28 8 VAL A 23 ? ? -82.63 40.22 29 8 ALA A 24 ? ? -176.65 -51.58 30 9 ALA A 4 ? ? 58.69 16.57 31 9 SER A 5 ? ? -140.66 -79.13 32 9 VAL A 11 ? ? -38.73 -27.22 33 9 LYS A 22 ? ? -37.96 -32.61 34 9 ALA A 24 ? ? -163.77 14.94 35 10 ALA A 4 ? ? 68.89 -7.62 36 10 SER A 5 ? ? -109.84 -72.63 37 10 VAL A 23 ? ? -90.41 40.71 38 11 SER A 5 ? ? 77.31 -60.03 39 11 LYS A 22 ? ? -106.81 47.86 40 12 SER A 5 ? ? 80.30 -62.51 41 12 LYS A 22 ? ? -112.04 71.45 42 13 GLU A 2 ? ? -85.75 36.33 43 13 ALA A 4 ? ? -155.36 8.18 44 13 SER A 5 ? ? -106.37 -64.88 45 13 VAL A 25 ? ? 64.81 162.08 46 14 ALA A 4 ? ? -132.00 -39.38 47 14 ALA A 24 ? ? -131.05 -68.36 48 15 SER A 5 ? ? 80.30 -62.51 49 15 LYS A 22 ? ? -112.04 71.45 50 16 ALA A 4 ? ? 58.69 16.57 51 16 SER A 5 ? ? -140.66 -79.13 52 16 VAL A 11 ? ? -38.73 -27.22 53 16 LYS A 22 ? ? -37.96 -32.61 54 16 ALA A 24 ? ? -163.77 14.94 55 17 ALA A 4 ? ? -132.00 -39.38 56 17 ALA A 24 ? ? -131.05 -68.36 57 18 SER A 5 ? ? 77.31 -60.03 58 18 LYS A 22 ? ? -106.81 47.86 59 19 SER A 5 ? ? 80.30 -62.51 60 19 LYS A 22 ? ? -112.04 71.45 61 20 TYR A 3 ? ? -88.02 46.58 62 20 VAL A 23 ? ? -87.07 41.61 63 20 ALA A 24 ? ? -166.89 80.27 # _pdbx_nmr_ensemble.entry_id 1VTP _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLN N N N N 47 GLN CA C N S 48 GLN C C N N 49 GLN O O N N 50 GLN CB C N N 51 GLN CG C N N 52 GLN CD C N N 53 GLN OE1 O N N 54 GLN NE2 N N N 55 GLN OXT O N N 56 GLN H H N N 57 GLN H2 H N N 58 GLN HA H N N 59 GLN HB2 H N N 60 GLN HB3 H N N 61 GLN HG2 H N N 62 GLN HG3 H N N 63 GLN HE21 H N N 64 GLN HE22 H N N 65 GLN HXT H N N 66 GLU N N N N 67 GLU CA C N S 68 GLU C C N N 69 GLU O O N N 70 GLU CB C N N 71 GLU CG C N N 72 GLU CD C N N 73 GLU OE1 O N N 74 GLU OE2 O N N 75 GLU OXT O N N 76 GLU H H N N 77 GLU H2 H N N 78 GLU HA H N N 79 GLU HB2 H N N 80 GLU HB3 H N N 81 GLU HG2 H N N 82 GLU HG3 H N N 83 GLU HE2 H N N 84 GLU HXT H N N 85 GLY N N N N 86 GLY CA C N N 87 GLY C C N N 88 GLY O O N N 89 GLY OXT O N N 90 GLY H H N N 91 GLY H2 H N N 92 GLY HA2 H N N 93 GLY HA3 H N N 94 GLY HXT H N N 95 LEU N N N N 96 LEU CA C N S 97 LEU C C N N 98 LEU O O N N 99 LEU CB C N N 100 LEU CG C N N 101 LEU CD1 C N N 102 LEU CD2 C N N 103 LEU OXT O N N 104 LEU H H N N 105 LEU H2 H N N 106 LEU HA H N N 107 LEU HB2 H N N 108 LEU HB3 H N N 109 LEU HG H N N 110 LEU HD11 H N N 111 LEU HD12 H N N 112 LEU HD13 H N N 113 LEU HD21 H N N 114 LEU HD22 H N N 115 LEU HD23 H N N 116 LEU HXT H N N 117 LYS N N N N 118 LYS CA C N S 119 LYS C C N N 120 LYS O O N N 121 LYS CB C N N 122 LYS CG C N N 123 LYS CD C N N 124 LYS CE C N N 125 LYS NZ N N N 126 LYS OXT O N N 127 LYS H H N N 128 LYS H2 H N N 129 LYS HA H N N 130 LYS HB2 H N N 131 LYS HB3 H N N 132 LYS HG2 H N N 133 LYS HG3 H N N 134 LYS HD2 H N N 135 LYS HD3 H N N 136 LYS HE2 H N N 137 LYS HE3 H N N 138 LYS HZ1 H N N 139 LYS HZ2 H N N 140 LYS HZ3 H N N 141 LYS HXT H N N 142 SER N N N N 143 SER CA C N S 144 SER C C N N 145 SER O O N N 146 SER CB C N N 147 SER OG O N N 148 SER OXT O N N 149 SER H H N N 150 SER H2 H N N 151 SER HA H N N 152 SER HB2 H N N 153 SER HB3 H N N 154 SER HG H N N 155 SER HXT H N N 156 TYR N N N N 157 TYR CA C N S 158 TYR C C N N 159 TYR O O N N 160 TYR CB C N N 161 TYR CG C Y N 162 TYR CD1 C Y N 163 TYR CD2 C Y N 164 TYR CE1 C Y N 165 TYR CE2 C Y N 166 TYR CZ C Y N 167 TYR OH O N N 168 TYR OXT O N N 169 TYR H H N N 170 TYR H2 H N N 171 TYR HA H N N 172 TYR HB2 H N N 173 TYR HB3 H N N 174 TYR HD1 H N N 175 TYR HD2 H N N 176 TYR HE1 H N N 177 TYR HE2 H N N 178 TYR HH H N N 179 TYR HXT H N N 180 VAL N N N N 181 VAL CA C N S 182 VAL C C N N 183 VAL O O N N 184 VAL CB C N N 185 VAL CG1 C N N 186 VAL CG2 C N N 187 VAL OXT O N N 188 VAL H H N N 189 VAL H2 H N N 190 VAL HA H N N 191 VAL HB H N N 192 VAL HG11 H N N 193 VAL HG12 H N N 194 VAL HG13 H N N 195 VAL HG21 H N N 196 VAL HG22 H N N 197 VAL HG23 H N N 198 VAL HXT H N N 199 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 LEU N CA sing N N 90 LEU N H sing N N 91 LEU N H2 sing N N 92 LEU CA C sing N N 93 LEU CA CB sing N N 94 LEU CA HA sing N N 95 LEU C O doub N N 96 LEU C OXT sing N N 97 LEU CB CG sing N N 98 LEU CB HB2 sing N N 99 LEU CB HB3 sing N N 100 LEU CG CD1 sing N N 101 LEU CG CD2 sing N N 102 LEU CG HG sing N N 103 LEU CD1 HD11 sing N N 104 LEU CD1 HD12 sing N N 105 LEU CD1 HD13 sing N N 106 LEU CD2 HD21 sing N N 107 LEU CD2 HD22 sing N N 108 LEU CD2 HD23 sing N N 109 LEU OXT HXT sing N N 110 LYS N CA sing N N 111 LYS N H sing N N 112 LYS N H2 sing N N 113 LYS CA C sing N N 114 LYS CA CB sing N N 115 LYS CA HA sing N N 116 LYS C O doub N N 117 LYS C OXT sing N N 118 LYS CB CG sing N N 119 LYS CB HB2 sing N N 120 LYS CB HB3 sing N N 121 LYS CG CD sing N N 122 LYS CG HG2 sing N N 123 LYS CG HG3 sing N N 124 LYS CD CE sing N N 125 LYS CD HD2 sing N N 126 LYS CD HD3 sing N N 127 LYS CE NZ sing N N 128 LYS CE HE2 sing N N 129 LYS CE HE3 sing N N 130 LYS NZ HZ1 sing N N 131 LYS NZ HZ2 sing N N 132 LYS NZ HZ3 sing N N 133 LYS OXT HXT sing N N 134 SER N CA sing N N 135 SER N H sing N N 136 SER N H2 sing N N 137 SER CA C sing N N 138 SER CA CB sing N N 139 SER CA HA sing N N 140 SER C O doub N N 141 SER C OXT sing N N 142 SER CB OG sing N N 143 SER CB HB2 sing N N 144 SER CB HB3 sing N N 145 SER OG HG sing N N 146 SER OXT HXT sing N N 147 TYR N CA sing N N 148 TYR N H sing N N 149 TYR N H2 sing N N 150 TYR CA C sing N N 151 TYR CA CB sing N N 152 TYR CA HA sing N N 153 TYR C O doub N N 154 TYR C OXT sing N N 155 TYR CB CG sing N N 156 TYR CB HB2 sing N N 157 TYR CB HB3 sing N N 158 TYR CG CD1 doub Y N 159 TYR CG CD2 sing Y N 160 TYR CD1 CE1 sing Y N 161 TYR CD1 HD1 sing N N 162 TYR CD2 CE2 doub Y N 163 TYR CD2 HD2 sing N N 164 TYR CE1 CZ doub Y N 165 TYR CE1 HE1 sing N N 166 TYR CE2 CZ sing Y N 167 TYR CE2 HE2 sing N N 168 TYR CZ OH sing N N 169 TYR OH HH sing N N 170 TYR OXT HXT sing N N 171 VAL N CA sing N N 172 VAL N H sing N N 173 VAL N H2 sing N N 174 VAL CA C sing N N 175 VAL CA CB sing N N 176 VAL CA HA sing N N 177 VAL C O doub N N 178 VAL C OXT sing N N 179 VAL CB CG1 sing N N 180 VAL CB CG2 sing N N 181 VAL CB HB sing N N 182 VAL CG1 HG11 sing N N 183 VAL CG1 HG12 sing N N 184 VAL CG1 HG13 sing N N 185 VAL CG2 HG21 sing N N 186 VAL CG2 HG22 sing N N 187 VAL CG2 HG23 sing N N 188 VAL OXT HXT sing N N 189 # _atom_sites.entry_id 1VTP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_