data_1VZB # _entry.id 1VZB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1VZB WWPDB D_1000177154 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1VZB _pdbx_database_status.recvd_initial_deposition_date 1996-09-18 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Birdsall, D.L.' 1 'Finer-Moore, J.' 2 'Stroud, R.M.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;The separate effects of E60Q in Lactobacillus casei thymidylate synthase delineate between mechanisms for formation of intermediates in catalysis. ; 'Protein Eng.' 11 171 183 1998 PRENE9 UK 0269-2139 0859 ? 9613841 10.1093/protein/11.3.171 1 'Refined Structures of Substrate-Bound and Phosphate-Bound Thymidylate Synthase from Lactobacillus Casei' J.Mol.Biol. 232 1101 ? 1993 JMOBAK UK 0022-2836 0070 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Birdsall, D.L.' 1 primary 'Huang, W.' 2 primary 'Santi, D.V.' 3 primary 'Stroud, R.M.' 4 primary 'Finer-Moore, J.' 5 1 'Finer-Moore, J.' 6 1 'Fauman, E.B.' 7 1 'Foster, P.G.' 8 1 'Perry, K.M.' 9 1 'Santi, D.V.' 10 1 'Stroud, R.M.' 11 # _cell.entry_id 1VZB _cell.length_a 78.300 _cell.length_b 78.300 _cell.length_c 242.300 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1VZB _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'THYMIDYLATE SYNTHASE' 36585.461 1 2.1.1.45 E60Q ? ? 2 non-polymer syn ;2'-DEOXYURIDINE 5'-MONOPHOSPHATE ; 308.182 1 ? ? ? ? 3 water nat water 18.015 44 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TS, LCTS' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSKGFPLLTTKKVPFGLIKSQLLWFLHGDTNIRFLLQHRNH IWDEWAFEKWVKSDEYHGPDMTDFGHRSQKAPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTSKGDT IDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVNDGKLSLQLYQRSADIFLGVPFNIASYALLTHLV AHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDFDMKDIKLLNYDPYPAIKAPVAV ; _entity_poly.pdbx_seq_one_letter_code_can ;MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSKGFPLLTTKKVPFGLIKSQLLWFLHGDTNIRFLLQHRNH IWDEWAFEKWVKSDEYHGPDMTDFGHRSQKAPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTSKGDT IDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVNDGKLSLQLYQRSADIFLGVPFNIASYALLTHLV AHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDFDMKDIKLLNYDPYPAIKAPVAV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 GLU n 1 4 GLN n 1 5 PRO n 1 6 TYR n 1 7 LEU n 1 8 ASP n 1 9 LEU n 1 10 ALA n 1 11 LYS n 1 12 LYS n 1 13 VAL n 1 14 LEU n 1 15 ASP n 1 16 GLU n 1 17 GLY n 1 18 HIS n 1 19 PHE n 1 20 LYS n 1 21 PRO n 1 22 ASP n 1 23 ARG n 1 24 THR n 1 25 HIS n 1 26 THR n 1 27 GLY n 1 28 THR n 1 29 TYR n 1 30 SER n 1 31 ILE n 1 32 PHE n 1 33 GLY n 1 34 HIS n 1 35 GLN n 1 36 MET n 1 37 ARG n 1 38 PHE n 1 39 ASP n 1 40 LEU n 1 41 SER n 1 42 LYS n 1 43 GLY n 1 44 PHE n 1 45 PRO n 1 46 LEU n 1 47 LEU n 1 48 THR n 1 49 THR n 1 50 LYS n 1 51 LYS n 1 52 VAL n 1 53 PRO n 1 54 PHE n 1 55 GLY n 1 56 LEU n 1 57 ILE n 1 58 LYS n 1 59 SER n 1 60 GLN n 1 61 LEU n 1 62 LEU n 1 63 TRP n 1 64 PHE n 1 65 LEU n 1 66 HIS n 1 67 GLY n 1 68 ASP n 1 69 THR n 1 70 ASN n 1 71 ILE n 1 72 ARG n 1 73 PHE n 1 74 LEU n 1 75 LEU n 1 76 GLN n 1 77 HIS n 1 78 ARG n 1 79 ASN n 1 80 HIS n 1 81 ILE n 1 82 TRP n 1 83 ASP n 1 84 GLU n 1 85 TRP n 1 86 ALA n 1 87 PHE n 1 88 GLU n 1 89 LYS n 1 90 TRP n 1 91 VAL n 1 92 LYS n 1 93 SER n 1 94 ASP n 1 95 GLU n 1 96 TYR n 1 97 HIS n 1 98 GLY n 1 99 PRO n 1 100 ASP n 1 101 MET n 1 102 THR n 1 103 ASP n 1 104 PHE n 1 105 GLY n 1 106 HIS n 1 107 ARG n 1 108 SER n 1 109 GLN n 1 110 LYS n 1 111 ALA n 1 112 PRO n 1 113 GLU n 1 114 PHE n 1 115 ALA n 1 116 ALA n 1 117 VAL n 1 118 TYR n 1 119 HIS n 1 120 GLU n 1 121 GLU n 1 122 MET n 1 123 ALA n 1 124 LYS n 1 125 PHE n 1 126 ASP n 1 127 ASP n 1 128 ARG n 1 129 VAL n 1 130 LEU n 1 131 HIS n 1 132 ASP n 1 133 ASP n 1 134 ALA n 1 135 PHE n 1 136 ALA n 1 137 ALA n 1 138 LYS n 1 139 TYR n 1 140 GLY n 1 141 ASP n 1 142 LEU n 1 143 GLY n 1 144 LEU n 1 145 VAL n 1 146 TYR n 1 147 GLY n 1 148 SER n 1 149 GLN n 1 150 TRP n 1 151 ARG n 1 152 ALA n 1 153 TRP n 1 154 HIS n 1 155 THR n 1 156 SER n 1 157 LYS n 1 158 GLY n 1 159 ASP n 1 160 THR n 1 161 ILE n 1 162 ASP n 1 163 GLN n 1 164 LEU n 1 165 GLY n 1 166 ASP n 1 167 VAL n 1 168 ILE n 1 169 GLU n 1 170 GLN n 1 171 ILE n 1 172 LYS n 1 173 THR n 1 174 HIS n 1 175 PRO n 1 176 TYR n 1 177 SER n 1 178 ARG n 1 179 ARG n 1 180 LEU n 1 181 ILE n 1 182 VAL n 1 183 SER n 1 184 ALA n 1 185 TRP n 1 186 ASN n 1 187 PRO n 1 188 GLU n 1 189 ASP n 1 190 VAL n 1 191 PRO n 1 192 THR n 1 193 MET n 1 194 ALA n 1 195 LEU n 1 196 PRO n 1 197 PRO n 1 198 CYS n 1 199 HIS n 1 200 THR n 1 201 LEU n 1 202 TYR n 1 203 GLN n 1 204 PHE n 1 205 TYR n 1 206 VAL n 1 207 ASN n 1 208 ASP n 1 209 GLY n 1 210 LYS n 1 211 LEU n 1 212 SER n 1 213 LEU n 1 214 GLN n 1 215 LEU n 1 216 TYR n 1 217 GLN n 1 218 ARG n 1 219 SER n 1 220 ALA n 1 221 ASP n 1 222 ILE n 1 223 PHE n 1 224 LEU n 1 225 GLY n 1 226 VAL n 1 227 PRO n 1 228 PHE n 1 229 ASN n 1 230 ILE n 1 231 ALA n 1 232 SER n 1 233 TYR n 1 234 ALA n 1 235 LEU n 1 236 LEU n 1 237 THR n 1 238 HIS n 1 239 LEU n 1 240 VAL n 1 241 ALA n 1 242 HIS n 1 243 GLU n 1 244 CYS n 1 245 GLY n 1 246 LEU n 1 247 GLU n 1 248 VAL n 1 249 GLY n 1 250 GLU n 1 251 PHE n 1 252 ILE n 1 253 HIS n 1 254 THR n 1 255 PHE n 1 256 GLY n 1 257 ASP n 1 258 ALA n 1 259 HIS n 1 260 LEU n 1 261 TYR n 1 262 VAL n 1 263 ASN n 1 264 HIS n 1 265 LEU n 1 266 ASP n 1 267 GLN n 1 268 ILE n 1 269 LYS n 1 270 GLU n 1 271 GLN n 1 272 LEU n 1 273 SER n 1 274 ARG n 1 275 THR n 1 276 PRO n 1 277 ARG n 1 278 PRO n 1 279 ALA n 1 280 PRO n 1 281 THR n 1 282 LEU n 1 283 GLN n 1 284 LEU n 1 285 ASN n 1 286 PRO n 1 287 ASP n 1 288 LYS n 1 289 HIS n 1 290 ASP n 1 291 ILE n 1 292 PHE n 1 293 ASP n 1 294 PHE n 1 295 ASP n 1 296 MET n 1 297 LYS n 1 298 ASP n 1 299 ILE n 1 300 LYS n 1 301 LEU n 1 302 LEU n 1 303 ASN n 1 304 TYR n 1 305 ASP n 1 306 PRO n 1 307 TYR n 1 308 PRO n 1 309 ALA n 1 310 ILE n 1 311 LYS n 1 312 ALA n 1 313 PRO n 1 314 VAL n 1 315 ALA n 1 316 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Lactobacillus _entity_src_gen.pdbx_gene_src_gene 'THYMIDYLATE SYNTHASE' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lactobacillus casei' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1582 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene 'THYMIDYLATE SYNTHASE' _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'X(CHI)2913 THY-' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PSCTS13 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TYSY_LACCA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00469 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSKGFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNH IWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTSKGDT IDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVNDGKLSLQLYQRSADIFLGVPFNIASYALLTHLV AHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDFDMKDIKLLNYDPYPAIKAPVAV ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1VZB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 316 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00469 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 316 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 316 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1VZB GLN A 60 ? UNP P00469 GLU 60 ENGINEERED 60 1 1 1VZB ALA A 111 ? UNP P00469 ASP 111 CONFLICT 111 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 UMP non-polymer . ;2'-DEOXYURIDINE 5'-MONOPHOSPHATE ; DUMP 'C9 H13 N2 O8 P' 308.182 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1VZB _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.93 _exptl_crystal.density_percent_sol 58.00 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type RIGAKU _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source ? _diffrn_source.type ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1VZB _reflns.observed_criterion_sigma_I 1.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low ? _reflns.d_resolution_high ? _reflns.number_obs 11787 _reflns.number_all ? _reflns.percent_possible_obs 71.0 _reflns.pdbx_Rmerge_I_obs 0.1080000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.entry_id 1VZB _refine.ls_number_reflns_obs 11429 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1. _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 15. _refine.ls_d_res_high 2.5 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.2150000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2150000 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 24.1 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2590 _refine_hist.pdbx_number_atoms_nucleic_acid 20 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 238 _refine_hist.number_atoms_total 2848 _refine_hist.d_res_high 2.5 _refine_hist.d_res_low 15. # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.023 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 26.01 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.965 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARAM19X.PRO TOPH19X.PRO 'X-RAY DIFFRACTION' 2 ? ? 'X-RAY DIFFRACTION' # _struct.entry_id 1VZB _struct.title 'L. CASEI THYMIDYLATE SYNTHASE MUTANT E60Q BINARY COMPLEX WITH DUMP' _struct.pdbx_descriptor ;THYMIDYLATE SYNTHASE, 2'-DEOXYURIDINE 5'-MONOPHOSPHATE ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1VZB _struct_keywords.pdbx_keywords METHYLTRANSFERASE _struct_keywords.text 'METHYLTRANSFERASE, NUCLEOTIDE SYNTHASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 2 ? GLU A 16 ? LEU A 2 GLU A 16 5 ? 15 HELX_P HELX_P2 2 PHE A 54 ? HIS A 66 ? PHE A 54 HIS A 66 1 ? 13 HELX_P HELX_P3 3 ILE A 71 ? HIS A 77 ? ILE A 71 HIS A 77 1 ? 7 HELX_P HELX_P4 4 ASP A 83 ? VAL A 91 ? ASP A 83 VAL A 91 1 ? 9 HELX_P HELX_P5 5 HIS A 106 ? GLN A 109 ? HIS A 106 GLN A 109 1 ? 4 HELX_P HELX_P6 6 PHE A 114 ? HIS A 131 ? PHE A 114 HIS A 131 1 ? 18 HELX_P HELX_P7 7 PHE A 135 ? TYR A 139 ? PHE A 135 TYR A 139 1 ? 5 HELX_P HELX_P8 8 TYR A 146 ? ARG A 151 ? TYR A 146 ARG A 151 1 ? 6 HELX_P HELX_P9 9 GLN A 163 ? THR A 173 ? GLN A 163 THR A 173 1 ? 11 HELX_P HELX_P10 10 VAL A 226 ? CYS A 244 ? VAL A 226 CYS A 244 1 ? 19 HELX_P HELX_P11 11 LEU A 265 ? SER A 273 ? LEU A 265 SER A 273 1 ? 9 HELX_P HELX_P12 12 ILE A 291 ? ASP A 293 ? ILE A 291 ASP A 293 5 ? 3 HELX_P HELX_P13 13 MET A 296 ? ASP A 298 ? MET A 296 ASP A 298 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 5 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel B 1 2 ? anti-parallel B 2 3 ? parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 28 ? PHE A 32 ? THR A 28 PHE A 32 A 2 ASP A 257 ? TYR A 261 ? ASP A 257 TYR A 261 A 3 SER A 219 ? ASP A 221 ? SER A 219 ASP A 221 B 1 HIS A 34 ? ASP A 39 ? HIS A 34 ASP A 39 B 2 GLU A 247 ? PHE A 255 ? GLU A 247 PHE A 255 B 3 LYS A 210 ? GLN A 217 ? LYS A 210 GLN A 217 B 4 LEU A 201 ? ASN A 207 ? LEU A 201 ASN A 207 B 5 ILE A 181 ? SER A 183 ? ILE A 181 SER A 183 C 1 THR A 281 ? LEU A 284 ? THR A 281 LEU A 284 C 2 ILE A 299 ? LEU A 302 ? ILE A 299 LEU A 302 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 29 ? O TYR A 29 N LEU A 260 ? N LEU A 260 A 2 3 O ASP A 257 ? O ASP A 257 N ALA A 220 ? N ALA A 220 B 1 2 O HIS A 34 ? O HIS A 34 N PHE A 255 ? N PHE A 255 B 2 3 O GLU A 247 ? O GLU A 247 N LEU A 211 ? N LEU A 211 B 3 4 O LYS A 210 ? O LYS A 210 N ASN A 207 ? N ASN A 207 B 4 5 O TYR A 202 ? O TYR A 202 N VAL A 182 ? N VAL A 182 C 1 2 O THR A 281 ? O THR A 281 N LEU A 302 ? N LEU A 302 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 14 _struct_site.details 'BINDING SITE FOR RESIDUE UMP A 317' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 ARG A 23 ? ARG A 23 . ? 1_555 ? 2 AC1 14 ARG A 178 ? ARG A 178 . ? 11_554 ? 3 AC1 14 ARG A 179 ? ARG A 179 . ? 11_554 ? 4 AC1 14 LEU A 195 ? LEU A 195 . ? 1_555 ? 5 AC1 14 CYS A 198 ? CYS A 198 . ? 1_555 ? 6 AC1 14 HIS A 199 ? HIS A 199 . ? 1_555 ? 7 AC1 14 GLN A 217 ? GLN A 217 . ? 1_555 ? 8 AC1 14 ARG A 218 ? ARG A 218 . ? 1_555 ? 9 AC1 14 SER A 219 ? SER A 219 . ? 1_555 ? 10 AC1 14 ALA A 220 ? ALA A 220 . ? 1_555 ? 11 AC1 14 ASP A 221 ? ASP A 221 . ? 1_555 ? 12 AC1 14 ASN A 229 ? ASN A 229 . ? 1_555 ? 13 AC1 14 HIS A 259 ? HIS A 259 . ? 1_555 ? 14 AC1 14 TYR A 261 ? TYR A 261 . ? 1_555 ? # _database_PDB_matrix.entry_id 1VZB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1VZB _atom_sites.fract_transf_matrix[1][1] 0.012771 _atom_sites.fract_transf_matrix[1][2] 0.007374 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014747 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004127 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 TRP 63 63 63 TRP TRP A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 TRP 82 82 82 TRP TRP A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 TRP 85 85 85 TRP TRP A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 TRP 90 90 90 TRP TRP A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 MET 101 101 101 MET MET A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 PRO 112 112 112 PRO PRO A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 MET 122 122 122 MET MET A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 TRP 150 150 150 TRP TRP A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 TRP 153 153 153 TRP TRP A . n A 1 154 HIS 154 154 154 HIS HIS A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 SER 156 156 156 SER SER A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 GLN 163 163 163 GLN GLN A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 GLN 170 170 170 GLN GLN A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 THR 173 173 173 THR THR A . n A 1 174 HIS 174 174 174 HIS HIS A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 TYR 176 176 176 TYR TYR A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 ARG 178 178 178 ARG ARG A . n A 1 179 ARG 179 179 179 ARG ARG A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 ILE 181 181 181 ILE ILE A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 TRP 185 185 185 TRP TRP A . n A 1 186 ASN 186 186 186 ASN ASN A . n A 1 187 PRO 187 187 187 PRO PRO A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 ASP 189 189 189 ASP ASP A . n A 1 190 VAL 190 190 190 VAL VAL A . n A 1 191 PRO 191 191 191 PRO PRO A . n A 1 192 THR 192 192 192 THR THR A . n A 1 193 MET 193 193 193 MET MET A . n A 1 194 ALA 194 194 194 ALA ALA A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 PRO 196 196 196 PRO PRO A . n A 1 197 PRO 197 197 197 PRO PRO A . n A 1 198 CYS 198 198 198 CYS CYS A . n A 1 199 HIS 199 199 199 HIS HIS A . n A 1 200 THR 200 200 200 THR THR A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 TYR 202 202 202 TYR TYR A . n A 1 203 GLN 203 203 203 GLN GLN A . n A 1 204 PHE 204 204 204 PHE PHE A . n A 1 205 TYR 205 205 205 TYR TYR A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 ASN 207 207 207 ASN ASN A . n A 1 208 ASP 208 208 208 ASP ASP A . n A 1 209 GLY 209 209 209 GLY GLY A . n A 1 210 LYS 210 210 210 LYS LYS A . n A 1 211 LEU 211 211 211 LEU LEU A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 GLN 214 214 214 GLN GLN A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 TYR 216 216 216 TYR TYR A . n A 1 217 GLN 217 217 217 GLN GLN A . n A 1 218 ARG 218 218 218 ARG ARG A . n A 1 219 SER 219 219 219 SER SER A . n A 1 220 ALA 220 220 220 ALA ALA A . n A 1 221 ASP 221 221 221 ASP ASP A . n A 1 222 ILE 222 222 222 ILE ILE A . n A 1 223 PHE 223 223 223 PHE PHE A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 GLY 225 225 225 GLY GLY A . n A 1 226 VAL 226 226 226 VAL VAL A . n A 1 227 PRO 227 227 227 PRO PRO A . n A 1 228 PHE 228 228 228 PHE PHE A . n A 1 229 ASN 229 229 229 ASN ASN A . n A 1 230 ILE 230 230 230 ILE ILE A . n A 1 231 ALA 231 231 231 ALA ALA A . n A 1 232 SER 232 232 232 SER SER A . n A 1 233 TYR 233 233 233 TYR TYR A . n A 1 234 ALA 234 234 234 ALA ALA A . n A 1 235 LEU 235 235 235 LEU LEU A . n A 1 236 LEU 236 236 236 LEU LEU A . n A 1 237 THR 237 237 237 THR THR A . n A 1 238 HIS 238 238 238 HIS HIS A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 VAL 240 240 240 VAL VAL A . n A 1 241 ALA 241 241 241 ALA ALA A . n A 1 242 HIS 242 242 242 HIS HIS A . n A 1 243 GLU 243 243 243 GLU GLU A . n A 1 244 CYS 244 244 244 CYS CYS A . n A 1 245 GLY 245 245 245 GLY GLY A . n A 1 246 LEU 246 246 246 LEU LEU A . n A 1 247 GLU 247 247 247 GLU GLU A . n A 1 248 VAL 248 248 248 VAL VAL A . n A 1 249 GLY 249 249 249 GLY GLY A . n A 1 250 GLU 250 250 250 GLU GLU A . n A 1 251 PHE 251 251 251 PHE PHE A . n A 1 252 ILE 252 252 252 ILE ILE A . n A 1 253 HIS 253 253 253 HIS HIS A . n A 1 254 THR 254 254 254 THR THR A . n A 1 255 PHE 255 255 255 PHE PHE A . n A 1 256 GLY 256 256 256 GLY GLY A . n A 1 257 ASP 257 257 257 ASP ASP A . n A 1 258 ALA 258 258 258 ALA ALA A . n A 1 259 HIS 259 259 259 HIS HIS A . n A 1 260 LEU 260 260 260 LEU LEU A . n A 1 261 TYR 261 261 261 TYR TYR A . n A 1 262 VAL 262 262 262 VAL VAL A . n A 1 263 ASN 263 263 263 ASN ASN A . n A 1 264 HIS 264 264 264 HIS HIS A . n A 1 265 LEU 265 265 265 LEU LEU A . n A 1 266 ASP 266 266 266 ASP ASP A . n A 1 267 GLN 267 267 267 GLN GLN A . n A 1 268 ILE 268 268 268 ILE ILE A . n A 1 269 LYS 269 269 269 LYS LYS A . n A 1 270 GLU 270 270 270 GLU GLU A . n A 1 271 GLN 271 271 271 GLN GLN A . n A 1 272 LEU 272 272 272 LEU LEU A . n A 1 273 SER 273 273 273 SER SER A . n A 1 274 ARG 274 274 274 ARG ARG A . n A 1 275 THR 275 275 275 THR THR A . n A 1 276 PRO 276 276 276 PRO PRO A . n A 1 277 ARG 277 277 277 ARG ARG A . n A 1 278 PRO 278 278 278 PRO PRO A . n A 1 279 ALA 279 279 279 ALA ALA A . n A 1 280 PRO 280 280 280 PRO PRO A . n A 1 281 THR 281 281 281 THR THR A . n A 1 282 LEU 282 282 282 LEU LEU A . n A 1 283 GLN 283 283 283 GLN GLN A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 ASN 285 285 285 ASN ASN A . n A 1 286 PRO 286 286 286 PRO PRO A . n A 1 287 ASP 287 287 287 ASP ASP A . n A 1 288 LYS 288 288 288 LYS LYS A . n A 1 289 HIS 289 289 289 HIS HIS A . n A 1 290 ASP 290 290 290 ASP ASP A . n A 1 291 ILE 291 291 291 ILE ILE A . n A 1 292 PHE 292 292 292 PHE PHE A . n A 1 293 ASP 293 293 293 ASP ASP A . n A 1 294 PHE 294 294 294 PHE PHE A . n A 1 295 ASP 295 295 295 ASP ASP A . n A 1 296 MET 296 296 296 MET MET A . n A 1 297 LYS 297 297 297 LYS LYS A . n A 1 298 ASP 298 298 298 ASP ASP A . n A 1 299 ILE 299 299 299 ILE ILE A . n A 1 300 LYS 300 300 300 LYS LYS A . n A 1 301 LEU 301 301 301 LEU LEU A . n A 1 302 LEU 302 302 302 LEU LEU A . n A 1 303 ASN 303 303 303 ASN ASN A . n A 1 304 TYR 304 304 304 TYR TYR A . n A 1 305 ASP 305 305 305 ASP ASP A . n A 1 306 PRO 306 306 306 PRO PRO A . n A 1 307 TYR 307 307 307 TYR TYR A . n A 1 308 PRO 308 308 308 PRO PRO A . n A 1 309 ALA 309 309 309 ALA ALA A . n A 1 310 ILE 310 310 310 ILE ILE A . n A 1 311 LYS 311 311 311 LYS LYS A . n A 1 312 ALA 312 312 312 ALA ALA A . n A 1 313 PRO 313 313 313 PRO PRO A . n A 1 314 VAL 314 314 314 VAL VAL A . n A 1 315 ALA 315 315 315 ALA ALA A . n A 1 316 VAL 316 316 316 VAL VAL A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 UMP 1 317 317 UMP UMP A . C 3 HOH 1 333 333 HOH HOH A . C 3 HOH 2 336 336 HOH HOH A . C 3 HOH 3 337 337 HOH HOH A . C 3 HOH 4 338 338 HOH HOH A . C 3 HOH 5 350 350 HOH HOH A . C 3 HOH 6 354 354 HOH HOH A . C 3 HOH 7 356 356 HOH HOH A . C 3 HOH 8 357 357 HOH HOH A . C 3 HOH 9 358 358 HOH HOH A . C 3 HOH 10 359 359 HOH HOH A . C 3 HOH 11 360 360 HOH HOH A . C 3 HOH 12 363 363 HOH HOH A . C 3 HOH 13 364 364 HOH HOH A . C 3 HOH 14 365 365 HOH HOH A . C 3 HOH 15 366 366 HOH HOH A . C 3 HOH 16 368 368 HOH HOH A . C 3 HOH 17 369 369 HOH HOH A . C 3 HOH 18 371 371 HOH HOH A . C 3 HOH 19 373 373 HOH HOH A . C 3 HOH 20 374 374 HOH HOH A . C 3 HOH 21 375 375 HOH HOH A . C 3 HOH 22 376 376 HOH HOH A . C 3 HOH 23 377 377 HOH HOH A . C 3 HOH 24 378 378 HOH HOH A . C 3 HOH 25 379 379 HOH HOH A . C 3 HOH 26 380 380 HOH HOH A . C 3 HOH 27 381 381 HOH HOH A . C 3 HOH 28 382 382 HOH HOH A . C 3 HOH 29 383 383 HOH HOH A . C 3 HOH 30 384 384 HOH HOH A . C 3 HOH 31 385 385 HOH HOH A . C 3 HOH 32 386 386 HOH HOH A . C 3 HOH 33 387 387 HOH HOH A . C 3 HOH 34 388 388 HOH HOH A . C 3 HOH 35 389 389 HOH HOH A . C 3 HOH 36 390 390 HOH HOH A . C 3 HOH 37 391 391 HOH HOH A . C 3 HOH 38 392 392 HOH HOH A . C 3 HOH 39 393 393 HOH HOH A . C 3 HOH 40 394 394 HOH HOH A . C 3 HOH 41 395 395 HOH HOH A . C 3 HOH 42 396 396 HOH HOH A . C 3 HOH 43 397 397 HOH HOH A . C 3 HOH 44 398 398 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 11_554 -x+y,y,-z-1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -121.1500000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-03-12 2 'Structure model' 1 1 2008-03-04 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 PROCESS 'data reduction' . ? 3 PROCESS 'data scaling' . ? 4 X-PLOR phasing 3.1 ? 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OH A TYR 233 ? ? H2 A HOH 337 ? ? 1.56 2 1 OG A SER 232 ? ? H2 A HOH 357 ? ? 1.60 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 HH11 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ARG _pdbx_validate_symm_contact.auth_seq_id_1 23 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 HH21 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ARG _pdbx_validate_symm_contact.auth_seq_id_2 179 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 11_554 _pdbx_validate_symm_contact.dist 1.12 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 NE2 A HIS 80 ? ? CD2 A HIS 80 ? ? 1.300 1.373 -0.073 0.011 N 2 1 CB A GLU 95 ? ? CG A GLU 95 ? ? 1.656 1.517 0.139 0.019 N 3 1 CG A HIS 106 ? ? CD2 A HIS 106 ? ? 1.411 1.354 0.057 0.009 N 4 1 NE2 A HIS 199 ? ? CD2 A HIS 199 ? ? 1.305 1.373 -0.068 0.011 N 5 1 CA A SER 219 ? ? CB A SER 219 ? ? 1.401 1.525 -0.124 0.015 N 6 1 NE2 A HIS 242 ? ? CD2 A HIS 242 ? ? 1.307 1.373 -0.066 0.011 N 7 1 NE2 A HIS 253 ? ? CD2 A HIS 253 ? ? 1.293 1.373 -0.080 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A VAL 13 ? ? CB A VAL 13 ? ? CG1 A VAL 13 ? ? 120.47 110.90 9.57 1.50 N 2 1 CA A VAL 13 ? ? CB A VAL 13 ? ? CG2 A VAL 13 ? ? 97.27 110.90 -13.63 1.50 N 3 1 CA A MET 36 ? ? CB A MET 36 ? ? CG A MET 36 ? ? 127.60 113.30 14.30 1.70 N 4 1 N A ARG 37 ? ? CA A ARG 37 ? ? CB A ARG 37 ? ? 99.05 110.60 -11.55 1.80 N 5 1 NE A ARG 37 ? ? CZ A ARG 37 ? ? NH1 A ARG 37 ? ? 123.73 120.30 3.43 0.50 N 6 1 CA A LYS 42 ? ? CB A LYS 42 ? ? CG A LYS 42 ? ? 126.61 113.40 13.21 2.20 N 7 1 CG1 A VAL 52 ? ? CB A VAL 52 ? ? CG2 A VAL 52 ? ? 100.57 110.90 -10.33 1.60 N 8 1 CD1 A TRP 63 ? ? CG A TRP 63 ? ? CD2 A TRP 63 ? ? 114.12 106.30 7.82 0.80 N 9 1 CE2 A TRP 63 ? ? CD2 A TRP 63 ? ? CG A TRP 63 ? ? 101.24 107.30 -6.06 0.80 N 10 1 NE A ARG 72 ? ? CZ A ARG 72 ? ? NH2 A ARG 72 ? ? 113.24 120.30 -7.06 0.50 N 11 1 CE2 A TRP 82 ? ? CD2 A TRP 82 ? ? CG A TRP 82 ? ? 101.83 107.30 -5.47 0.80 N 12 1 CD1 A TRP 90 ? ? CG A TRP 90 ? ? CD2 A TRP 90 ? ? 114.53 106.30 8.23 0.80 N 13 1 CB A TRP 90 ? ? CG A TRP 90 ? ? CD1 A TRP 90 ? ? 118.62 127.00 -8.38 1.30 N 14 1 CG A TRP 90 ? ? CD1 A TRP 90 ? ? NE1 A TRP 90 ? ? 103.57 110.10 -6.53 1.00 N 15 1 CE2 A TRP 90 ? ? CD2 A TRP 90 ? ? CG A TRP 90 ? ? 100.67 107.30 -6.63 0.80 N 16 1 NE A ARG 107 ? ? CZ A ARG 107 ? ? NH2 A ARG 107 ? ? 116.45 120.30 -3.85 0.50 N 17 1 N A SER 108 ? ? CA A SER 108 ? ? C A SER 108 ? ? 92.49 111.00 -18.51 2.70 N 18 1 C A ALA 111 ? ? N A PRO 112 ? ? CA A PRO 112 ? ? 129.34 119.30 10.04 1.50 Y 19 1 CA A PRO 112 ? ? N A PRO 112 ? ? CD A PRO 112 ? ? 101.88 111.70 -9.82 1.40 N 20 1 N A PRO 112 ? ? CA A PRO 112 ? ? C A PRO 112 ? ? 129.69 112.10 17.59 2.60 N 21 1 NE A ARG 128 ? ? CZ A ARG 128 ? ? NH2 A ARG 128 ? ? 116.87 120.30 -3.43 0.50 N 22 1 CA A ASP 141 ? ? C A ASP 141 ? ? N A LEU 142 ? ? 102.52 117.20 -14.68 2.20 Y 23 1 CD1 A TRP 150 ? ? CG A TRP 150 ? ? CD2 A TRP 150 ? ? 114.02 106.30 7.72 0.80 N 24 1 CG A TRP 150 ? ? CD1 A TRP 150 ? ? NE1 A TRP 150 ? ? 103.17 110.10 -6.93 1.00 N 25 1 CE2 A TRP 150 ? ? CD2 A TRP 150 ? ? CG A TRP 150 ? ? 101.31 107.30 -5.99 0.80 N 26 1 CD1 A TRP 153 ? ? CG A TRP 153 ? ? CD2 A TRP 153 ? ? 113.19 106.30 6.89 0.80 N 27 1 CE2 A TRP 153 ? ? CD2 A TRP 153 ? ? CG A TRP 153 ? ? 101.60 107.30 -5.70 0.80 N 28 1 CA A GLY 158 ? ? C A GLY 158 ? ? N A ASP 159 ? ? 102.91 117.20 -14.29 2.20 Y 29 1 CB A ASP 162 ? ? CG A ASP 162 ? ? OD1 A ASP 162 ? ? 124.43 118.30 6.13 0.90 N 30 1 CG1 A VAL 167 ? ? CB A VAL 167 ? ? CG2 A VAL 167 ? ? 97.89 110.90 -13.01 1.60 N 31 1 CA A THR 173 ? ? C A THR 173 ? ? N A HIS 174 ? ? 131.98 117.20 14.78 2.20 Y 32 1 O A THR 173 ? ? C A THR 173 ? ? N A HIS 174 ? ? 111.12 122.70 -11.58 1.60 Y 33 1 NE A ARG 179 ? ? CZ A ARG 179 ? ? NH1 A ARG 179 ? ? 124.79 120.30 4.49 0.50 N 34 1 NE A ARG 179 ? ? CZ A ARG 179 ? ? NH2 A ARG 179 ? ? 117.06 120.30 -3.24 0.50 N 35 1 CD1 A TRP 185 ? ? CG A TRP 185 ? ? CD2 A TRP 185 ? ? 112.59 106.30 6.29 0.80 N 36 1 CE2 A TRP 185 ? ? CD2 A TRP 185 ? ? CG A TRP 185 ? ? 101.80 107.30 -5.50 0.80 N 37 1 CA A ASP 189 ? ? CB A ASP 189 ? ? CG A ASP 189 ? ? 129.01 113.40 15.61 2.20 N 38 1 CB A ASP 189 ? ? CG A ASP 189 ? ? OD1 A ASP 189 ? ? 126.21 118.30 7.91 0.90 N 39 1 CA A VAL 190 ? ? CB A VAL 190 ? ? CG2 A VAL 190 ? ? 101.88 110.90 -9.02 1.50 N 40 1 CA A MET 193 ? ? CB A MET 193 ? ? CG A MET 193 ? ? 125.97 113.30 12.67 1.70 N 41 1 CB A TYR 205 ? ? CG A TYR 205 ? ? CD2 A TYR 205 ? ? 116.57 121.00 -4.43 0.60 N 42 1 CB A TYR 216 ? ? CG A TYR 216 ? ? CD1 A TYR 216 ? ? 116.87 121.00 -4.13 0.60 N 43 1 CA A HIS 242 ? ? CB A HIS 242 ? ? CG A HIS 242 ? ? 124.19 113.60 10.59 1.70 N 44 1 N A VAL 248 ? ? CA A VAL 248 ? ? CB A VAL 248 ? ? 97.52 111.50 -13.98 2.20 N 45 1 CG1 A VAL 248 ? ? CB A VAL 248 ? ? CG2 A VAL 248 ? ? 121.29 110.90 10.39 1.60 N 46 1 CA A ASP 257 ? ? C A ASP 257 ? ? N A ALA 258 ? ? 133.02 117.20 15.82 2.20 Y 47 1 O A ASP 257 ? ? C A ASP 257 ? ? N A ALA 258 ? ? 112.90 122.70 -9.80 1.60 Y 48 1 CA A LEU 260 ? ? CB A LEU 260 ? ? CG A LEU 260 ? ? 131.30 115.30 16.00 2.30 N 49 1 NE A ARG 277 ? ? CZ A ARG 277 ? ? NH2 A ARG 277 ? ? 115.53 120.30 -4.77 0.50 N 50 1 CA A ILE 291 ? ? CB A ILE 291 ? ? CG2 A ILE 291 ? ? 98.00 110.90 -12.90 2.00 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 5 ? ? -37.84 -33.60 2 1 PRO A 21 ? ? -51.03 170.55 3 1 THR A 24 ? ? -105.07 -69.47 4 1 HIS A 25 ? ? 162.63 -30.80 5 1 THR A 26 ? ? -48.07 105.18 6 1 HIS A 34 ? ? -173.69 132.16 7 1 LYS A 42 ? ? -166.37 -30.05 8 1 PRO A 45 ? ? -66.38 47.22 9 1 LYS A 50 ? ? -170.89 137.95 10 1 PHE A 54 ? ? -32.07 -39.76 11 1 GLN A 76 ? ? -47.35 -11.94 12 1 ARG A 78 ? ? 32.23 50.33 13 1 ILE A 81 ? ? -36.07 -27.79 14 1 LYS A 92 ? ? -79.08 33.31 15 1 TYR A 96 ? ? -50.06 92.24 16 1 PRO A 99 ? ? -42.21 157.54 17 1 MET A 101 ? ? 43.03 -0.99 18 1 ASP A 103 ? ? 15.12 74.37 19 1 PHE A 104 ? ? -32.27 -95.85 20 1 SER A 108 ? ? -78.19 -85.92 21 1 GLN A 109 ? ? -23.25 -5.90 22 1 LYS A 110 ? ? -160.15 62.27 23 1 ALA A 111 ? ? -164.47 22.12 24 1 PRO A 112 ? ? 27.18 -34.60 25 1 VAL A 117 ? ? -49.81 -71.24 26 1 TYR A 118 ? ? -25.26 -51.35 27 1 ALA A 152 ? ? -164.50 71.56 28 1 THR A 155 ? ? -100.29 -161.44 29 1 SER A 156 ? ? -87.82 -77.25 30 1 ASP A 159 ? ? -4.84 -171.37 31 1 TYR A 176 ? ? -106.90 68.62 32 1 ALA A 194 ? ? -67.51 -106.86 33 1 ASP A 208 ? ? 57.07 10.77 34 1 ASN A 263 ? ? -94.83 43.92 35 1 HIS A 264 ? ? -144.37 -1.73 36 1 LEU A 272 ? ? -65.22 4.81 37 1 PRO A 276 ? ? -41.25 154.87 38 1 ASN A 303 ? ? 46.79 28.47 39 1 PRO A 313 ? ? -30.82 142.81 40 1 VAL A 314 ? ? -107.36 -70.08 41 1 ALA A 315 ? ? -134.17 -89.96 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 HIS A 25 ? ? 0.104 'SIDE CHAIN' 2 1 HIS A 34 ? ? 0.093 'SIDE CHAIN' 3 1 TYR A 176 ? ? 0.096 'SIDE CHAIN' 4 1 HIS A 259 ? ? 0.104 'SIDE CHAIN' # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;2'-DEOXYURIDINE 5'-MONOPHOSPHATE ; UMP 3 water HOH #