data_1WES # _entry.id 1WES # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WES pdb_00001wes 10.2210/pdb1wes/pdb RCSB RCSB023499 ? ? WWPDB D_1000023499 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmt007002223.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WES _pdbx_database_status.recvd_initial_deposition_date 2004-05-25 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'He, F.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Shirouzu, M.' 5 'Terada, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of PHD domain in inhibitor of growth family, member 1-like' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'He, F.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Shirouzu, M.' 5 ? primary 'Terada, T.' 6 ? primary 'Yokoyama, S.' 7 ? # _cell.entry_id 1WES _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1WES _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'inhibitor of growth family, member 1-like' 7743.573 1 ? ? 'PHD domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmt007002223.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLU n 1 9 PHE n 1 10 ALA n 1 11 ILE n 1 12 ASP n 1 13 PRO n 1 14 ASN n 1 15 GLU n 1 16 PRO n 1 17 THR n 1 18 TYR n 1 19 CYS n 1 20 LEU n 1 21 CYS n 1 22 ASN n 1 23 GLN n 1 24 VAL n 1 25 SER n 1 26 TYR n 1 27 GLY n 1 28 GLU n 1 29 MET n 1 30 ILE n 1 31 GLY n 1 32 CYS n 1 33 ASP n 1 34 ASN n 1 35 GLU n 1 36 GLN n 1 37 CYS n 1 38 PRO n 1 39 ILE n 1 40 GLU n 1 41 TRP n 1 42 PHE n 1 43 HIS n 1 44 PHE n 1 45 SER n 1 46 CYS n 1 47 VAL n 1 48 SER n 1 49 LEU n 1 50 THR n 1 51 TYR n 1 52 LYS n 1 53 PRO n 1 54 LYS n 1 55 GLY n 1 56 LYS n 1 57 TRP n 1 58 TYR n 1 59 CYS n 1 60 PRO n 1 61 LYS n 1 62 CYS n 1 63 ARG n 1 64 GLY n 1 65 ASP n 1 66 SER n 1 67 GLY n 1 68 PRO n 1 69 SER n 1 70 SER n 1 71 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene 'RIKEN cDNA 2810011M06' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P030408-27 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ING2_MOUSE _struct_ref.pdbx_db_accession Q9ESK4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGD _struct_ref.pdbx_align_begin 205 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WES _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 65 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9ESK4 _struct_ref_seq.db_align_beg 205 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 262 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 65 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WES GLY A 1 ? UNP Q9ESK4 ? ? 'cloning artifact' 1 1 1 1WES SER A 2 ? UNP Q9ESK4 ? ? 'cloning artifact' 2 2 1 1WES SER A 3 ? UNP Q9ESK4 ? ? 'cloning artifact' 3 3 1 1WES GLY A 4 ? UNP Q9ESK4 ? ? 'cloning artifact' 4 4 1 1WES SER A 5 ? UNP Q9ESK4 ? ? 'cloning artifact' 5 5 1 1WES SER A 6 ? UNP Q9ESK4 ? ? 'cloning artifact' 6 6 1 1WES GLY A 7 ? UNP Q9ESK4 ? ? 'cloning artifact' 7 7 1 1WES SER A 66 ? UNP Q9ESK4 ? ? 'cloning artifact' 66 8 1 1WES GLY A 67 ? UNP Q9ESK4 ? ? 'cloning artifact' 67 9 1 1WES PRO A 68 ? UNP Q9ESK4 ? ? 'cloning artifact' 68 10 1 1WES SER A 69 ? UNP Q9ESK4 ? ? 'cloning artifact' 69 11 1 1WES SER A 70 ? UNP Q9ESK4 ? ? 'cloning artifact' 70 12 1 1WES GLY A 71 ? UNP Q9ESK4 ? ? 'cloning artifact' 71 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_13C-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8mM U-15,13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 0.1mM ZnCl2; 1mM d-DTT; 0.02% NaN3; 90%H2O, 10%D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 # _pdbx_nmr_refine.entry_id 1WES _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1WES _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WES _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 NMRPipe 20020425 processing Delaglio,F. 2 NMRView 5.0.4 'data analysis' Johnson,B.A. 3 KUJIRA 0.863 'data analysis' Cobayashi,N. 4 CYANA 2.0.17 'structure solution' Guentert,P. 5 CYANA 2.0.17 refinement Guentert,P. 6 # _exptl.entry_id 1WES _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1WES _struct.title 'Solution structure of PHD domain in inhibitor of growth family, member 1-like' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WES _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text ;structural genomics, PHD domain, inhibitor of growth family, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PHE A 44 ? VAL A 47 ? PHE A 44 VAL A 47 1 ? 4 HELX_P HELX_P2 2 PRO A 60 ? ARG A 63 ? PRO A 60 ARG A 63 1 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 19 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 19 A ZN 201 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.326 ? ? metalc3 metalc ? ? A CYS 32 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 32 A ZN 401 1_555 ? ? ? ? ? ? ? 2.335 ? ? metalc4 metalc ? ? A CYS 37 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 37 A ZN 401 1_555 ? ? ? ? ? ? ? 2.334 ? ? metalc5 metalc ? ? A HIS 43 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 43 A ZN 201 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc6 metalc ? ? A CYS 46 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 46 A ZN 201 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc7 metalc ? ? A CYS 59 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 59 A ZN 401 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc8 metalc ? ? A CYS 62 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 62 A ZN 401 1_555 ? ? ? ? ? ? ? 2.341 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 29 ? ILE A 30 ? MET A 29 ILE A 30 A 2 PHE A 42 ? HIS A 43 ? PHE A 42 HIS A 43 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 30 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 30 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 42 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 42 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 19 ? CYS A 19 . ? 1_555 ? 2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 3 AC1 4 HIS A 43 ? HIS A 43 . ? 1_555 ? 4 AC1 4 CYS A 46 ? CYS A 46 . ? 1_555 ? 5 AC2 4 CYS A 32 ? CYS A 32 . ? 1_555 ? 6 AC2 4 CYS A 37 ? CYS A 37 . ? 1_555 ? 7 AC2 4 CYS A 59 ? CYS A 59 . ? 1_555 ? 8 AC2 4 CYS A 62 ? CYS A 62 . ? 1_555 ? # _database_PDB_matrix.entry_id 1WES _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WES _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 TRP 41 41 41 TRP TRP A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 GLY 71 71 71 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 109.7 ? 2 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 43 ? A HIS 43 ? 1_555 90.5 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 43 ? A HIS 43 ? 1_555 103.4 ? 4 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 46 ? A CYS 46 ? 1_555 112.4 ? 5 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 46 ? A CYS 46 ? 1_555 118.6 ? 6 ND1 ? A HIS 43 ? A HIS 43 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 46 ? A CYS 46 ? 1_555 118.4 ? 7 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 37 ? A CYS 37 ? 1_555 117.9 ? 8 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 59 ? A CYS 59 ? 1_555 117.9 ? 9 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 59 ? A CYS 59 ? 1_555 107.0 ? 10 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 62 ? A CYS 62 ? 1_555 117.8 ? 11 SG ? A CYS 37 ? A CYS 37 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 62 ? A CYS 62 ? 1_555 100.2 ? 12 SG ? A CYS 59 ? A CYS 59 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 62 ? A CYS 62 ? 1_555 91.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-25 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_ref_seq_dif 9 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.value' 10 4 'Structure model' '_struct_conn.pdbx_dist_value' 11 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 17 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 23 4 'Structure model' '_struct_ref_seq_dif.details' 24 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 25 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 26 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 18 ? ? -125.66 -64.52 2 1 CYS A 19 ? ? -40.91 163.06 3 1 ASP A 33 ? ? -39.55 -37.68 4 1 CYS A 37 ? ? -37.19 118.01 5 1 GLU A 40 ? ? 38.05 36.75 6 1 TRP A 41 ? ? -161.46 117.01 7 1 LYS A 54 ? ? -82.50 36.60 8 1 CYS A 59 ? ? -42.30 153.90 9 1 PRO A 60 ? ? -69.78 0.79 10 2 SER A 6 ? ? -47.15 150.95 11 2 ALA A 10 ? ? -162.32 108.09 12 2 PRO A 13 ? ? -69.71 10.38 13 2 ASN A 14 ? ? 72.12 40.39 14 2 CYS A 32 ? ? -52.36 108.06 15 2 ASP A 33 ? ? -34.76 -37.02 16 2 ASN A 34 ? ? -65.21 96.42 17 2 CYS A 37 ? ? -38.16 115.35 18 2 TRP A 41 ? ? -162.29 114.19 19 2 LYS A 54 ? ? -82.26 37.28 20 2 LYS A 56 ? ? -39.07 143.46 21 2 PRO A 60 ? ? -69.75 1.20 22 3 GLU A 8 ? ? -131.31 -33.16 23 3 PHE A 9 ? ? -42.89 105.30 24 3 PRO A 13 ? ? -69.78 1.48 25 3 ASN A 14 ? ? -103.56 40.06 26 3 PRO A 16 ? ? -69.79 -179.75 27 3 TYR A 18 ? ? -124.92 -72.71 28 3 CYS A 19 ? ? -36.81 155.23 29 3 ASN A 22 ? ? 74.50 46.46 30 3 TYR A 26 ? ? -131.88 -35.20 31 3 ASN A 34 ? ? -63.08 99.12 32 3 TRP A 41 ? ? -163.84 112.00 33 3 CYS A 59 ? ? -49.14 156.54 34 4 ILE A 11 ? ? -39.93 128.40 35 4 PRO A 13 ? ? -69.74 3.61 36 4 ASN A 14 ? ? 71.86 37.48 37 4 CYS A 19 ? ? -39.33 160.30 38 4 CYS A 32 ? ? -33.02 139.35 39 4 CYS A 37 ? ? -38.44 104.57 40 4 PRO A 38 ? ? -69.73 0.05 41 4 GLU A 40 ? ? 35.62 38.68 42 4 TRP A 41 ? ? -162.36 113.87 43 4 CYS A 59 ? ? -49.89 154.72 44 4 PRO A 68 ? ? -69.72 88.98 45 5 PRO A 16 ? ? -69.75 -179.61 46 5 TYR A 18 ? ? -133.15 -63.34 47 5 CYS A 19 ? ? -42.69 165.96 48 5 CYS A 32 ? ? -38.92 141.91 49 5 CYS A 37 ? ? -43.45 103.22 50 5 GLU A 40 ? ? 38.55 39.27 51 5 TRP A 41 ? ? -163.88 115.46 52 5 CYS A 59 ? ? -41.98 154.60 53 5 SER A 69 ? ? -83.13 39.64 54 6 SER A 6 ? ? -93.53 42.45 55 6 PRO A 16 ? ? -69.82 -178.64 56 6 TYR A 18 ? ? -133.37 -60.67 57 6 CYS A 19 ? ? -40.98 162.80 58 6 CYS A 32 ? ? -50.72 109.34 59 6 ASP A 33 ? ? -37.22 -31.06 60 6 PRO A 60 ? ? -69.73 1.79 61 6 SER A 70 ? ? -95.71 40.19 62 7 ALA A 10 ? ? -61.00 93.36 63 7 TYR A 18 ? ? -105.18 -63.82 64 7 CYS A 19 ? ? -40.73 159.68 65 7 SER A 25 ? ? -39.27 144.81 66 7 CYS A 32 ? ? -36.44 123.87 67 7 CYS A 37 ? ? -36.33 116.28 68 7 GLU A 40 ? ? 39.10 37.58 69 7 TRP A 41 ? ? -162.66 115.57 70 7 CYS A 59 ? ? -42.52 154.62 71 7 PRO A 60 ? ? -69.74 1.62 72 7 PRO A 68 ? ? -69.77 89.52 73 7 SER A 69 ? ? -83.18 45.04 74 8 ILE A 11 ? ? -56.90 105.52 75 8 ASN A 14 ? ? -109.89 65.56 76 8 TYR A 18 ? ? -124.16 -60.90 77 8 CYS A 19 ? ? -42.55 165.52 78 8 SER A 25 ? ? -56.34 108.31 79 8 CYS A 32 ? ? -41.02 109.63 80 8 ASP A 33 ? ? -38.77 -33.76 81 8 CYS A 37 ? ? -43.68 108.97 82 8 GLU A 40 ? ? 38.74 37.81 83 8 TRP A 41 ? ? -161.45 108.00 84 8 LYS A 52 ? ? -48.00 109.52 85 8 TRP A 57 ? ? -162.55 118.69 86 8 CYS A 59 ? ? -40.16 154.36 87 9 SER A 2 ? ? -115.47 79.80 88 9 SER A 5 ? ? -84.84 49.50 89 9 TYR A 18 ? ? -128.37 -64.76 90 9 CYS A 19 ? ? -44.50 166.04 91 9 ASP A 33 ? ? -34.53 -36.35 92 9 GLU A 40 ? ? 37.08 34.63 93 9 LYS A 52 ? ? -36.59 113.90 94 9 CYS A 59 ? ? -45.58 155.19 95 9 PRO A 60 ? ? -69.75 1.15 96 10 PRO A 16 ? ? -69.77 -171.07 97 10 TYR A 18 ? ? -121.00 -64.49 98 10 CYS A 19 ? ? -42.34 163.94 99 10 TRP A 41 ? ? -162.99 111.84 100 10 LYS A 52 ? ? -39.94 107.36 101 10 LYS A 54 ? ? -47.80 157.21 102 10 PRO A 60 ? ? -69.83 1.62 103 11 SER A 2 ? ? -51.08 104.68 104 11 PRO A 13 ? ? -69.80 4.02 105 11 TYR A 18 ? ? -131.52 -61.92 106 11 CYS A 19 ? ? -42.14 165.11 107 11 CYS A 32 ? ? -46.28 107.80 108 11 ASP A 33 ? ? -34.50 -39.24 109 11 GLN A 36 ? ? -35.90 -37.88 110 11 CYS A 37 ? ? -47.03 109.81 111 11 LYS A 52 ? ? -34.83 125.51 112 11 CYS A 59 ? ? -45.32 157.34 113 11 SER A 69 ? ? -107.61 41.13 114 12 SER A 6 ? ? -92.80 40.74 115 12 TYR A 18 ? ? -127.63 -64.91 116 12 CYS A 19 ? ? -40.25 161.27 117 12 TYR A 26 ? ? -132.66 -32.84 118 12 CYS A 32 ? ? -33.67 121.67 119 12 ASN A 34 ? ? -60.93 99.60 120 12 ILE A 39 ? ? -108.80 -64.03 121 12 TRP A 41 ? ? -162.99 113.61 122 12 LYS A 52 ? ? -34.84 105.83 123 12 LYS A 54 ? ? -45.36 161.59 124 12 CYS A 59 ? ? -45.83 153.62 125 13 ILE A 11 ? ? -39.67 104.86 126 13 PRO A 16 ? ? -69.75 -175.22 127 13 TYR A 18 ? ? -129.39 -65.94 128 13 CYS A 19 ? ? -46.30 166.54 129 13 ASP A 33 ? ? 37.78 26.97 130 13 CYS A 37 ? ? -48.05 105.58 131 13 TRP A 41 ? ? -162.79 119.96 132 13 LYS A 52 ? ? -53.45 109.82 133 13 CYS A 59 ? ? -40.47 153.40 134 13 PRO A 60 ? ? -69.74 0.80 135 14 SER A 3 ? ? -134.47 -61.05 136 14 SER A 6 ? ? -55.25 172.96 137 14 ASN A 14 ? ? -81.96 44.52 138 14 TYR A 18 ? ? -122.94 -63.59 139 14 CYS A 19 ? ? -40.86 154.82 140 14 TYR A 26 ? ? -130.47 -31.62 141 14 CYS A 32 ? ? -39.72 139.81 142 14 CYS A 37 ? ? -38.57 101.61 143 14 PRO A 38 ? ? -69.72 0.67 144 14 GLU A 40 ? ? 34.71 37.52 145 14 TRP A 41 ? ? -165.71 115.44 146 14 PHE A 44 ? ? -91.57 -60.47 147 14 VAL A 47 ? ? -86.27 30.86 148 14 CYS A 59 ? ? -45.35 156.24 149 15 ALA A 10 ? ? -62.54 99.83 150 15 PRO A 16 ? ? -69.75 -179.19 151 15 TYR A 18 ? ? -132.64 -63.60 152 15 CYS A 19 ? ? -40.26 161.86 153 15 TYR A 26 ? ? -134.48 -35.96 154 15 CYS A 32 ? ? -34.24 118.74 155 15 GLN A 36 ? ? -38.39 -39.33 156 15 CYS A 37 ? ? -38.23 117.42 157 15 GLU A 40 ? ? 34.92 32.12 158 15 TRP A 41 ? ? -162.88 116.78 159 15 CYS A 59 ? ? -46.18 153.61 160 15 PRO A 60 ? ? -69.78 1.53 161 15 ASP A 65 ? ? -103.10 42.59 162 16 SER A 2 ? ? -171.93 145.37 163 16 SER A 6 ? ? -51.06 174.99 164 16 PHE A 9 ? ? -41.42 101.10 165 16 ASN A 14 ? ? -81.42 43.22 166 16 PRO A 16 ? ? -69.77 -175.85 167 16 TYR A 18 ? ? -107.95 -62.84 168 16 CYS A 19 ? ? -42.66 161.56 169 16 TYR A 26 ? ? -135.00 -65.20 170 16 ASN A 34 ? ? -64.27 98.48 171 16 GLN A 36 ? ? -39.69 -29.91 172 16 PRO A 38 ? ? -69.81 2.12 173 16 TRP A 41 ? ? -163.98 113.98 174 16 LYS A 52 ? ? -35.20 119.80 175 16 CYS A 59 ? ? -42.78 156.12 176 17 SER A 6 ? ? -162.71 112.87 177 17 TYR A 18 ? ? -133.72 -54.57 178 17 ASP A 33 ? ? -39.45 -39.25 179 17 GLU A 40 ? ? 35.89 37.27 180 17 TRP A 41 ? ? -161.29 116.93 181 17 LYS A 52 ? ? -39.06 120.78 182 17 PRO A 53 ? ? -69.80 -177.44 183 17 LYS A 54 ? ? -55.57 -179.61 184 17 PRO A 60 ? ? -69.73 0.68 185 17 SER A 66 ? ? -38.63 152.12 186 17 PRO A 68 ? ? -69.80 99.57 187 18 PRO A 13 ? ? -69.71 1.48 188 18 PRO A 16 ? ? -69.80 -169.14 189 18 CYS A 19 ? ? -44.49 169.48 190 18 CYS A 37 ? ? -42.33 106.44 191 18 GLU A 40 ? ? 38.71 32.52 192 18 CYS A 59 ? ? -38.33 155.57 193 18 ASP A 65 ? ? -33.73 132.87 194 18 PRO A 68 ? ? -69.71 -170.90 195 19 PRO A 13 ? ? -69.75 7.44 196 19 CYS A 19 ? ? -44.01 155.14 197 19 TYR A 26 ? ? -134.96 -58.55 198 19 CYS A 32 ? ? -34.75 120.58 199 19 ASN A 34 ? ? -65.28 98.64 200 19 PRO A 38 ? ? -69.77 2.57 201 19 GLU A 40 ? ? 39.03 39.26 202 19 TRP A 41 ? ? -163.03 115.02 203 19 SER A 48 ? ? 33.20 54.90 204 19 CYS A 59 ? ? -39.76 154.75 205 19 PRO A 60 ? ? -69.76 1.75 206 19 SER A 70 ? ? -47.20 151.44 207 20 SER A 3 ? ? -99.65 42.10 208 20 PRO A 16 ? ? -69.78 -175.18 209 20 TYR A 18 ? ? -124.68 -62.56 210 20 CYS A 19 ? ? -49.17 163.67 211 20 PRO A 38 ? ? -69.77 1.37 212 20 ILE A 39 ? ? -107.14 -62.06 213 20 TRP A 41 ? ? -163.81 118.13 214 20 LYS A 52 ? ? -33.67 124.42 215 20 CYS A 59 ? ? -38.44 155.74 216 20 PRO A 60 ? ? -69.68 1.75 217 20 PRO A 68 ? ? -69.77 0.88 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #