data_1WFW # _entry.id 1WFW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WFW pdb_00001wfw 10.2210/pdb1wfw/pdb RCSB RCSB023535 ? ? WWPDB D_1000023535 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmt007008182.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WFW _pdbx_database_status.recvd_initial_deposition_date 2004-05-27 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tochio, N.' 1 'Koshiba, S.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Yokoyama, S.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of SH3 domain of mouse Kalirin-9a protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tochio, N.' 1 ? primary 'Koshiba, S.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Yokoyama, S.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Kalirin-9a _entity.formula_weight 7636.433 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'S209G, K237E' _entity.pdbx_fragment 'SH3 domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'unnamed protein product' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGSTMTVIKDYYALKENEICVSQGEVVQVLAVNQQNMCLVYQPASDHSPAAEGWVPGSILAPFSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGSTMTVIKDYYALKENEICVSQGEVVQVLAVNQQNMCLVYQPASDHSPAAEGWVPGSILAPFSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmt007008182.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 THR n 1 10 MET n 1 11 THR n 1 12 VAL n 1 13 ILE n 1 14 LYS n 1 15 ASP n 1 16 TYR n 1 17 TYR n 1 18 ALA n 1 19 LEU n 1 20 LYS n 1 21 GLU n 1 22 ASN n 1 23 GLU n 1 24 ILE n 1 25 CYS n 1 26 VAL n 1 27 SER n 1 28 GLN n 1 29 GLY n 1 30 GLU n 1 31 VAL n 1 32 VAL n 1 33 GLN n 1 34 VAL n 1 35 LEU n 1 36 ALA n 1 37 VAL n 1 38 ASN n 1 39 GLN n 1 40 GLN n 1 41 ASN n 1 42 MET n 1 43 CYS n 1 44 LEU n 1 45 VAL n 1 46 TYR n 1 47 GLN n 1 48 PRO n 1 49 ALA n 1 50 SER n 1 51 ASP n 1 52 HIS n 1 53 SER n 1 54 PRO n 1 55 ALA n 1 56 ALA n 1 57 GLU n 1 58 GLY n 1 59 TRP n 1 60 VAL n 1 61 PRO n 1 62 GLY n 1 63 SER n 1 64 ILE n 1 65 LEU n 1 66 ALA n 1 67 PRO n 1 68 PHE n 1 69 SER n 1 70 GLY n 1 71 PRO n 1 72 SER n 1 73 SER n 1 74 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene 'RIKEN cDNA 2210407G14' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P030120-92 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name GB _struct_ref.db_code BAB25925 _struct_ref.pdbx_db_accession 12843281 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code STMTVIKDYYALKENEICVSQSEVVQVLAVNQQNMCLVYQPASDHSPAAKGWVPGSILAPF _struct_ref.pdbx_align_begin 188 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WFW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 68 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 12843281 _struct_ref_seq.db_align_beg 188 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 248 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 68 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WFW GLY A 1 ? GB 12843281 ? ? 'cloning artifact' 1 1 1 1WFW SER A 2 ? GB 12843281 ? ? 'cloning artifact' 2 2 1 1WFW SER A 3 ? GB 12843281 ? ? 'cloning artifact' 3 3 1 1WFW GLY A 4 ? GB 12843281 ? ? 'cloning artifact' 4 4 1 1WFW SER A 5 ? GB 12843281 ? ? 'cloning artifact' 5 5 1 1WFW SER A 6 ? GB 12843281 ? ? 'cloning artifact' 6 6 1 1WFW GLY A 7 ? GB 12843281 ? ? 'cloning artifact' 7 7 1 1WFW GLY A 29 ? GB 12843281 SER 209 'engineered mutation' 29 8 1 1WFW GLU A 57 ? GB 12843281 LYS 237 'engineered mutation' 57 9 1 1WFW SER A 69 ? GB 12843281 ? ? 'cloning artifact' 69 10 1 1WFW GLY A 70 ? GB 12843281 ? ? 'cloning artifact' 70 11 1 1WFW PRO A 71 ? GB 12843281 ? ? 'cloning artifact' 71 12 1 1WFW SER A 72 ? GB 12843281 ? ? 'cloning artifact' 72 13 1 1WFW SER A 73 ? GB 12843281 ? ? 'cloning artifact' 73 14 1 1WFW GLY A 74 ? GB 12843281 ? ? 'cloning artifact' 74 15 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM SH3 domain U-15N, 13C; 20mM d-Tris HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 # _pdbx_nmr_refine.entry_id 1WFW _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1WFW _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WFW _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 NMRPipe 20031121 processing 'Delaglio, F.' 2 NMRView 5.0.4 'data analysis' 'Johnson, B.A.' 3 KUJIRA 0.8994 'data analysis' 'Kobayashi, N.' 4 CYANA 2.0.17 'structure solution' 'Guentert, P.' 5 CYANA 2.0.17 refinement 'Guentert, P.' 6 # _exptl.entry_id 1WFW _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1WFW _struct.title 'Solution structure of SH3 domain of mouse Kalirin-9a protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WFW _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;SH3 domain, neuron-specific GDP/GTP exchange factor, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 63 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 65 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 63 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 65 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 9 ? THR A 11 ? THR A 9 THR A 11 A 2 VAL A 31 ? VAL A 37 ? VAL A 31 VAL A 37 A 3 MET A 42 ? GLN A 47 ? MET A 42 GLN A 47 A 4 ALA A 56 ? PRO A 61 ? ALA A 56 PRO A 61 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N MET A 10 ? N MET A 10 O VAL A 32 ? O VAL A 32 A 2 3 N GLN A 33 ? N GLN A 33 O TYR A 46 ? O TYR A 46 A 3 4 N GLN A 47 ? N GLN A 47 O ALA A 56 ? O ALA A 56 # _database_PDB_matrix.entry_id 1WFW _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WFW _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 GLY 74 74 74 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-27 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 28 ? ? -59.26 108.79 2 1 LEU A 44 ? ? -57.96 95.87 3 1 ALA A 49 ? ? -38.73 129.93 4 1 PRO A 67 ? ? -69.73 99.74 5 1 SER A 72 ? ? 35.35 52.69 6 2 SER A 2 ? ? -44.06 165.11 7 2 GLU A 30 ? ? -49.68 159.09 8 2 ALA A 36 ? ? -174.52 -177.68 9 2 LEU A 44 ? ? -66.89 99.06 10 2 PHE A 68 ? ? -68.55 84.77 11 3 SER A 3 ? ? -98.57 42.28 12 3 GLN A 28 ? ? -52.80 107.74 13 3 GLU A 30 ? ? -48.14 171.96 14 3 ALA A 36 ? ? -173.21 -176.99 15 4 SER A 5 ? ? -56.49 97.37 16 4 GLN A 28 ? ? -56.83 106.55 17 4 ASN A 41 ? ? 73.54 35.94 18 4 LEU A 44 ? ? -62.38 98.74 19 4 ALA A 55 ? ? -47.92 106.75 20 4 PRO A 67 ? ? -69.72 94.36 21 4 PRO A 71 ? ? -69.74 2.77 22 4 SER A 73 ? ? -128.25 -58.59 23 5 GLU A 30 ? ? -48.56 155.68 24 5 ALA A 36 ? ? -175.09 -178.19 25 5 ALA A 49 ? ? -33.92 125.76 26 5 PRO A 54 ? ? -69.86 -178.16 27 5 PRO A 67 ? ? -69.68 93.68 28 5 PRO A 71 ? ? -69.76 85.49 29 5 SER A 72 ? ? -171.37 108.60 30 6 LEU A 44 ? ? -61.63 98.60 31 6 PRO A 54 ? ? -69.80 -173.85 32 6 SER A 69 ? ? 37.08 39.99 33 6 PRO A 71 ? ? -69.81 95.77 34 7 ALA A 18 ? ? -58.78 96.16 35 7 GLU A 30 ? ? -43.62 151.23 36 7 ALA A 49 ? ? -39.61 134.17 37 7 PRO A 54 ? ? -69.78 -176.26 38 7 ILE A 64 ? ? -93.17 30.94 39 7 PRO A 67 ? ? -69.73 93.27 40 8 GLU A 30 ? ? -50.53 175.88 41 8 LEU A 44 ? ? -47.96 104.88 42 8 ALA A 49 ? ? -36.98 116.59 43 8 PRO A 67 ? ? -69.82 97.10 44 9 SER A 2 ? ? -170.62 127.66 45 9 ASP A 15 ? ? -48.82 156.30 46 9 PRO A 54 ? ? -69.77 -179.34 47 9 PRO A 67 ? ? -69.77 95.56 48 10 SER A 3 ? ? -43.70 102.68 49 10 SER A 6 ? ? -108.24 41.97 50 10 LEU A 44 ? ? -62.85 98.16 51 10 ALA A 49 ? ? -33.84 127.41 52 10 SER A 69 ? ? -163.60 110.24 53 10 PRO A 71 ? ? -69.79 -178.27 54 11 GLU A 30 ? ? -47.36 162.07 55 11 ALA A 36 ? ? -174.14 -179.76 56 11 ALA A 49 ? ? -39.56 124.30 57 11 PRO A 54 ? ? -69.74 -176.40 58 11 PRO A 67 ? ? -69.83 96.10 59 11 PRO A 71 ? ? -69.73 99.69 60 12 GLU A 30 ? ? -54.95 171.58 61 12 ALA A 36 ? ? -171.41 -176.19 62 12 LEU A 44 ? ? -63.69 97.07 63 12 ALA A 49 ? ? -50.38 108.74 64 12 PRO A 54 ? ? -69.76 -178.73 65 12 PRO A 67 ? ? -69.80 98.71 66 12 SER A 72 ? ? -37.84 143.04 67 12 SER A 73 ? ? -122.24 -56.76 68 13 ALA A 18 ? ? -36.18 132.01 69 13 GLU A 30 ? ? -47.19 169.27 70 13 ALA A 36 ? ? -174.76 -178.27 71 13 LEU A 44 ? ? -52.61 105.76 72 13 ALA A 49 ? ? -59.05 106.46 73 13 HIS A 52 ? ? -114.66 51.24 74 13 SER A 53 ? ? -173.94 143.06 75 13 PRO A 54 ? ? -69.76 -175.26 76 13 PRO A 67 ? ? -69.70 97.24 77 13 SER A 73 ? ? -58.87 100.58 78 14 ALA A 36 ? ? -173.45 -179.92 79 14 ALA A 49 ? ? -34.40 137.17 80 14 PRO A 67 ? ? -69.71 97.67 81 14 PHE A 68 ? ? -58.45 94.30 82 14 PRO A 71 ? ? -69.83 2.27 83 14 SER A 72 ? ? -34.67 107.95 84 15 GLU A 30 ? ? -42.79 158.01 85 15 ASN A 41 ? ? 72.19 35.44 86 15 LEU A 44 ? ? -56.97 98.27 87 15 ALA A 49 ? ? -33.99 106.90 88 15 PRO A 67 ? ? -69.76 99.60 89 15 SER A 72 ? ? -109.78 45.43 90 16 GLU A 23 ? ? -49.23 150.28 91 16 ALA A 49 ? ? -34.99 116.87 92 16 PRO A 67 ? ? -69.79 99.62 93 16 SER A 72 ? ? -51.12 87.99 94 17 SER A 2 ? ? -130.69 -47.79 95 17 SER A 5 ? ? -82.26 43.36 96 17 ALA A 36 ? ? -170.85 -178.03 97 17 ALA A 49 ? ? -38.36 120.07 98 17 PRO A 67 ? ? -69.77 95.71 99 18 SER A 5 ? ? -86.01 41.63 100 18 ALA A 18 ? ? -34.91 125.29 101 18 ALA A 36 ? ? -172.46 -176.09 102 18 LEU A 44 ? ? -51.89 109.30 103 18 PRO A 54 ? ? -69.84 -166.31 104 18 PRO A 67 ? ? -69.77 93.75 105 18 PRO A 71 ? ? -69.78 0.68 106 19 SER A 2 ? ? -109.21 42.31 107 19 GLU A 30 ? ? -50.14 171.05 108 19 ALA A 36 ? ? -175.30 -177.30 109 19 ASN A 41 ? ? 71.52 37.72 110 19 LEU A 44 ? ? -53.01 94.77 111 19 ASP A 51 ? ? -48.54 108.53 112 19 PRO A 67 ? ? -69.72 94.49 113 19 SER A 73 ? ? 70.99 38.19 114 20 SER A 2 ? ? -130.22 -51.79 115 20 SER A 3 ? ? -45.54 104.34 116 20 SER A 6 ? ? -35.41 121.80 117 20 GLU A 30 ? ? -47.45 151.30 118 20 ALA A 36 ? ? -173.85 -177.28 119 20 LEU A 44 ? ? -59.85 96.54 120 20 PRO A 67 ? ? -69.72 95.30 #