data_1WFZ # _entry.id 1WFZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WFZ pdb_00001wfz 10.2210/pdb1wfz/pdb RCSB RCSB023538 ? ? WWPDB D_1000023538 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmk001001342.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WFZ _pdbx_database_status.recvd_initial_deposition_date 2004-05-27 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nakanishi, T.' 1 'Tomizawa, T.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structure of Iron-sulfur cluster protein U (IscU)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nakanishi, T.' 1 ? primary 'Tomizawa, T.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # _cell.entry_id 1WFZ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1WFZ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'nitrogen fixation cluster-like' 13444.322 1 ? ? IscU ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Iron-sulfur cluster protein U' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEE ALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQESKSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEE ALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQESKSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmk001001342.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLU n 1 9 ASN n 1 10 PRO n 1 11 ARG n 1 12 ASN n 1 13 VAL n 1 14 GLY n 1 15 SER n 1 16 LEU n 1 17 ASP n 1 18 LYS n 1 19 THR n 1 20 SER n 1 21 LYS n 1 22 ASN n 1 23 VAL n 1 24 GLY n 1 25 THR n 1 26 GLY n 1 27 LEU n 1 28 VAL n 1 29 GLY n 1 30 ALA n 1 31 PRO n 1 32 ALA n 1 33 CYS n 1 34 GLY n 1 35 ASP n 1 36 VAL n 1 37 MET n 1 38 LYS n 1 39 LEU n 1 40 GLN n 1 41 ILE n 1 42 GLN n 1 43 VAL n 1 44 ASP n 1 45 GLU n 1 46 LYS n 1 47 GLY n 1 48 LYS n 1 49 ILE n 1 50 VAL n 1 51 ASP n 1 52 ALA n 1 53 ARG n 1 54 PHE n 1 55 LYS n 1 56 THR n 1 57 PHE n 1 58 GLY n 1 59 CYS n 1 60 GLY n 1 61 SER n 1 62 ALA n 1 63 ILE n 1 64 ALA n 1 65 SER n 1 66 SER n 1 67 SER n 1 68 LEU n 1 69 ALA n 1 70 THR n 1 71 GLU n 1 72 TRP n 1 73 VAL n 1 74 LYS n 1 75 GLY n 1 76 LYS n 1 77 THR n 1 78 VAL n 1 79 GLU n 1 80 GLU n 1 81 ALA n 1 82 LEU n 1 83 THR n 1 84 ILE n 1 85 LYS n 1 86 ASN n 1 87 THR n 1 88 ASP n 1 89 ILE n 1 90 ALA n 1 91 LYS n 1 92 GLU n 1 93 LEU n 1 94 CYS n 1 95 LEU n 1 96 PRO n 1 97 PRO n 1 98 VAL n 1 99 LYS n 1 100 LEU n 1 101 HIS n 1 102 CYS n 1 103 SER n 1 104 MET n 1 105 LEU n 1 106 ALA n 1 107 GLU n 1 108 ASP n 1 109 ALA n 1 110 ILE n 1 111 LYS n 1 112 ALA n 1 113 ALA n 1 114 LEU n 1 115 ALA n 1 116 ASP n 1 117 TYR n 1 118 LYS n 1 119 LEU n 1 120 LYS n 1 121 GLN n 1 122 GLU n 1 123 SER n 1 124 LYS n 1 125 SER n 1 126 GLY n 1 127 PRO n 1 128 SER n 1 129 SER n 1 130 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene 'RIKEN cDNA 2300003J05' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P020826-02 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NIFUN_MOUSE _struct_ref.pdbx_db_accession Q9D7P6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNT DIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQESK ; _struct_ref.pdbx_align_begin 45 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WFZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9D7P6 _struct_ref_seq.db_align_beg 45 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 161 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 124 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WFZ GLY A 1 ? UNP Q9D7P6 ? ? 'cloning artifact' 1 1 1 1WFZ SER A 2 ? UNP Q9D7P6 ? ? 'cloning artifact' 2 2 1 1WFZ SER A 3 ? UNP Q9D7P6 ? ? 'cloning artifact' 3 3 1 1WFZ GLY A 4 ? UNP Q9D7P6 ? ? 'cloning artifact' 4 4 1 1WFZ SER A 5 ? UNP Q9D7P6 ? ? 'cloning artifact' 5 5 1 1WFZ SER A 6 ? UNP Q9D7P6 ? ? 'cloning artifact' 6 6 1 1WFZ GLY A 7 ? UNP Q9D7P6 ? ? 'cloning artifact' 7 7 1 1WFZ SER A 125 ? UNP Q9D7P6 ? ? 'cloning artifact' 125 8 1 1WFZ GLY A 126 ? UNP Q9D7P6 ? ? 'cloning artifact' 126 9 1 1WFZ PRO A 127 ? UNP Q9D7P6 ? ? 'cloning artifact' 127 10 1 1WFZ SER A 128 ? UNP Q9D7P6 ? ? 'cloning artifact' 128 11 1 1WFZ SER A 129 ? UNP Q9D7P6 ? ? 'cloning artifact' 129 12 1 1WFZ GLY A 130 ? UNP Q9D7P6 ? ? 'cloning artifact' 130 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_13C-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.12mM IscU domain U-15N, 13C; 20mM d-Tris-HCl; 100mM NaCl; 10mM d-DTT; 0.02% NaN3; 0.01mM ZnCl2; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 # _pdbx_nmr_ensemble.entry_id 1WFZ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WFZ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 NMRPipe 20030801 processing 'Delaglio, F.' 2 NMRView 5.0.4 'data analysis' 'Johnson, B.A.' 3 KUJIRA 0.870 'data analysis' 'Kobayashi, N.' 4 CYANA 2.0.17 'structure solution' 'Guntert, P.' 5 CYANA 2.0.17 refinement 'Guntert, P.' 6 # _exptl.entry_id 1WFZ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1WFZ _struct.title 'Solution structure of Iron-sulfur cluster protein U (IscU)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WFZ _struct_keywords.pdbx_keywords 'METAL TRANSPORT' _struct_keywords.text ;Iron-sulfur cluster biosynthesis, three conserved Cys, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL TRANSPORT ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 60 ? VAL A 73 ? GLY A 60 VAL A 73 1 ? 14 HELX_P HELX_P2 2 VAL A 78 ? ALA A 81 ? VAL A 78 ALA A 81 1 ? 4 HELX_P HELX_P3 3 ASN A 86 ? GLU A 92 ? ASN A 86 GLU A 92 1 ? 7 HELX_P HELX_P4 4 CYS A 102 ? GLN A 121 ? CYS A 102 GLN A 121 5 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 33 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 33 A ZN 201 1_555 ? ? ? ? ? ? ? 2.331 ? ? metalc2 metalc ? ? A ASP 35 OD2 ? ? ? 1_555 B ZN . ZN ? ? A ASP 35 A ZN 201 1_555 ? ? ? ? ? ? ? 2.068 ? ? metalc3 metalc ? ? A CYS 59 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 59 A ZN 201 1_555 ? ? ? ? ? ? ? 2.279 ? ? metalc4 metalc ? ? A HIS 101 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 101 A ZN 201 1_555 ? ? ? ? ? ? ? 2.088 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 23 ? ALA A 30 ? VAL A 23 ALA A 30 A 2 ASP A 35 ? VAL A 43 ? ASP A 35 VAL A 43 A 3 ILE A 49 ? PHE A 57 ? ILE A 49 PHE A 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 26 ? N GLY A 26 O LEU A 39 ? O LEU A 39 A 2 3 N LYS A 38 ? N LYS A 38 O LYS A 55 ? O LYS A 55 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 33 ? CYS A 33 . ? 1_555 ? 2 AC1 5 ASP A 35 ? ASP A 35 . ? 1_555 ? 3 AC1 5 CYS A 59 ? CYS A 59 . ? 1_555 ? 4 AC1 5 HIS A 101 ? HIS A 101 . ? 1_555 ? 5 AC1 5 CYS A 102 ? CYS A 102 . ? 1_555 ? # _database_PDB_matrix.entry_id 1WFZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WFZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 TRP 72 72 72 TRP TRP A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 CYS 94 94 94 CYS CYS A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 CYS 102 102 102 CYS CYS A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 MET 104 104 104 MET MET A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 TYR 117 117 117 TYR TYR A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 GLN 121 121 121 GLN GLN A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 GLY 130 130 130 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 33 ? A CYS 33 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 OD2 ? A ASP 35 ? A ASP 35 ? 1_555 102.8 ? 2 SG ? A CYS 33 ? A CYS 33 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 59 ? A CYS 59 ? 1_555 117.3 ? 3 OD2 ? A ASP 35 ? A ASP 35 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 59 ? A CYS 59 ? 1_555 110.0 ? 4 SG ? A CYS 33 ? A CYS 33 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 101 ? A HIS 101 ? 1_555 101.9 ? 5 OD2 ? A ASP 35 ? A ASP 35 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 101 ? A HIS 101 ? 1_555 113.0 ? 6 SG ? A CYS 59 ? A CYS 59 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 101 ? A HIS 101 ? 1_555 111.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-27 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 4 'Structure model' '_struct_ref_seq_dif.details' 18 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 19 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 20 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? -69.15 95.92 2 1 GLU A 8 ? ? 37.63 38.16 3 1 ASN A 9 ? ? -34.44 140.25 4 1 PRO A 10 ? ? -69.70 -164.45 5 1 ASP A 17 ? ? -54.25 101.25 6 1 SER A 61 ? ? -34.95 -33.84 7 1 HIS A 101 ? ? -38.91 -37.24 8 1 ALA A 113 ? ? -60.34 -71.24 9 2 SER A 2 ? ? -95.07 41.77 10 2 GLU A 8 ? ? -42.84 101.35 11 2 PRO A 10 ? ? -69.70 -179.76 12 2 ASN A 12 ? ? -62.55 78.11 13 2 CYS A 59 ? ? -59.90 177.18 14 2 SER A 61 ? ? -34.82 -34.10 15 2 HIS A 101 ? ? -37.77 -37.39 16 2 ALA A 113 ? ? -53.19 -70.44 17 2 ALA A 115 ? ? -45.80 -70.32 18 2 SER A 123 ? ? -174.26 -175.05 19 2 PRO A 127 ? ? -69.75 -173.10 20 3 VAL A 13 ? ? -38.74 112.36 21 3 SER A 15 ? ? -169.67 118.64 22 3 SER A 61 ? ? -36.98 -30.16 23 3 SER A 65 ? ? -39.79 -37.00 24 3 SER A 129 ? ? -65.89 81.32 25 4 ARG A 11 ? ? -95.16 -68.39 26 4 SER A 61 ? ? -35.19 -33.81 27 4 ALA A 90 ? ? -36.04 -37.78 28 4 HIS A 101 ? ? -38.11 -31.87 29 4 LYS A 124 ? ? -132.60 -43.75 30 5 PRO A 10 ? ? -69.74 -168.70 31 5 SER A 15 ? ? -32.20 118.12 32 5 ASP A 17 ? ? -55.11 101.21 33 5 SER A 61 ? ? -35.05 -37.75 34 5 ALA A 90 ? ? -38.15 -37.38 35 5 SER A 125 ? ? -39.48 100.91 36 6 SER A 5 ? ? -170.43 127.47 37 6 SER A 15 ? ? -172.06 140.55 38 6 SER A 61 ? ? -35.22 -34.07 39 6 SER A 65 ? ? -38.59 -32.43 40 6 SER A 67 ? ? -39.60 -29.17 41 6 HIS A 101 ? ? -37.84 -36.72 42 6 ALA A 113 ? ? -58.37 -72.01 43 6 LYS A 124 ? ? -85.18 45.30 44 6 PRO A 127 ? ? -69.76 86.46 45 7 PRO A 10 ? ? -69.71 -175.04 46 7 ASN A 12 ? ? -66.16 89.78 47 7 SER A 61 ? ? -34.90 -32.49 48 7 ALA A 64 ? ? -65.70 -70.15 49 7 HIS A 101 ? ? -38.44 -27.24 50 7 ALA A 113 ? ? -58.68 -74.53 51 7 ALA A 115 ? ? -42.92 -70.98 52 7 SER A 123 ? ? -52.54 102.76 53 7 SER A 125 ? ? 34.38 42.05 54 8 PRO A 10 ? ? -69.81 -164.69 55 8 ASN A 12 ? ? 71.95 41.79 56 8 ASP A 17 ? ? -57.97 101.80 57 8 SER A 61 ? ? -37.98 -28.34 58 8 HIS A 101 ? ? -38.06 -34.01 59 8 ASP A 108 ? ? -39.20 -39.38 60 8 ALA A 113 ? ? -58.64 -75.04 61 8 PRO A 127 ? ? -69.75 4.34 62 9 ARG A 11 ? ? -121.71 -51.78 63 9 ASN A 12 ? ? -35.20 -39.67 64 9 SER A 15 ? ? -174.87 129.11 65 9 ALA A 64 ? ? -64.11 -70.02 66 9 SER A 67 ? ? -39.09 -37.47 67 9 HIS A 101 ? ? -38.01 -33.55 68 9 ALA A 113 ? ? -57.05 -71.45 69 9 ALA A 115 ? ? -42.46 -70.12 70 9 PRO A 127 ? ? -69.75 88.07 71 9 SER A 128 ? ? -96.91 43.37 72 9 SER A 129 ? ? 38.08 42.21 73 10 SER A 61 ? ? -36.01 -38.66 74 10 ALA A 64 ? ? -63.32 -70.08 75 10 ALA A 113 ? ? -54.18 -71.22 76 10 LYS A 124 ? ? -106.12 41.20 77 10 SER A 128 ? ? -125.99 -62.15 78 11 PRO A 10 ? ? -69.76 -172.36 79 11 ARG A 11 ? ? -122.00 -63.44 80 11 ASN A 12 ? ? -63.18 80.22 81 11 SER A 20 ? ? -58.66 173.56 82 11 CYS A 59 ? ? -58.62 -175.38 83 11 SER A 61 ? ? -35.42 -31.26 84 11 THR A 70 ? ? -46.36 -19.71 85 11 HIS A 101 ? ? -38.66 -38.16 86 11 ALA A 113 ? ? -53.88 -71.04 87 11 LYS A 124 ? ? -164.37 112.95 88 11 SER A 125 ? ? -133.10 -51.84 89 12 PRO A 10 ? ? -69.78 -171.57 90 12 ARG A 11 ? ? -133.30 -53.95 91 12 SER A 15 ? ? -162.05 112.62 92 12 ASN A 22 ? ? -35.65 -34.95 93 12 SER A 61 ? ? -36.07 -32.59 94 12 HIS A 101 ? ? -37.84 -35.16 95 12 ALA A 113 ? ? -58.03 -71.05 96 12 PRO A 127 ? ? -69.70 -177.87 97 12 SER A 129 ? ? -35.05 135.66 98 13 SER A 5 ? ? -160.38 112.57 99 13 PRO A 10 ? ? -69.78 -178.99 100 13 ARG A 11 ? ? -131.28 -51.43 101 13 ASN A 12 ? ? -37.50 -38.00 102 13 SER A 15 ? ? -175.01 148.99 103 13 ASP A 17 ? ? -54.03 104.36 104 13 SER A 61 ? ? -35.57 -38.89 105 13 ILE A 84 ? ? -46.49 106.74 106 13 THR A 87 ? ? -38.84 -32.24 107 13 HIS A 101 ? ? -37.50 -34.00 108 13 ALA A 113 ? ? -58.35 -72.01 109 13 SER A 123 ? ? 33.89 41.24 110 13 SER A 125 ? ? 34.00 44.74 111 14 PRO A 10 ? ? -69.78 -175.08 112 14 ASN A 12 ? ? -83.39 42.35 113 14 SER A 15 ? ? -161.88 110.98 114 14 CYS A 59 ? ? -49.19 166.89 115 14 SER A 61 ? ? -35.33 -37.84 116 14 HIS A 101 ? ? -39.96 -38.30 117 14 ALA A 113 ? ? -54.03 -70.43 118 14 SER A 123 ? ? -128.45 -74.69 119 14 SER A 125 ? ? -43.15 92.78 120 15 SER A 5 ? ? -45.80 161.14 121 15 SER A 6 ? ? -173.53 137.32 122 15 VAL A 13 ? ? -39.09 132.93 123 15 SER A 61 ? ? -35.39 -33.18 124 15 HIS A 101 ? ? -38.00 -35.28 125 15 ALA A 113 ? ? -59.43 -70.51 126 15 SER A 125 ? ? 34.24 42.77 127 15 PRO A 127 ? ? -69.76 -177.86 128 15 SER A 129 ? ? -37.02 143.94 129 16 PRO A 10 ? ? -69.74 -167.24 130 16 ARG A 11 ? ? -124.92 -69.89 131 16 ASN A 12 ? ? -98.40 -70.75 132 16 SER A 15 ? ? -173.77 114.64 133 16 SER A 20 ? ? -42.92 165.95 134 16 SER A 61 ? ? -35.92 -36.58 135 16 HIS A 101 ? ? -37.75 -39.24 136 16 ALA A 113 ? ? -54.57 -70.69 137 17 SER A 15 ? ? -164.94 110.37 138 17 SER A 61 ? ? -35.46 -31.41 139 17 ALA A 113 ? ? -58.22 -72.30 140 17 SER A 123 ? ? 35.56 42.43 141 18 GLU A 8 ? ? -102.07 44.66 142 18 PRO A 10 ? ? -69.73 -164.38 143 18 SER A 15 ? ? -35.57 134.28 144 18 SER A 61 ? ? -37.98 -33.64 145 18 ALA A 90 ? ? -35.26 -34.29 146 18 HIS A 101 ? ? -37.92 -38.39 147 18 ALA A 113 ? ? -62.88 -72.58 148 18 SER A 125 ? ? -66.92 78.80 149 19 SER A 2 ? ? -134.03 -60.51 150 19 SER A 5 ? ? -124.75 -51.00 151 19 VAL A 13 ? ? -35.18 133.31 152 19 SER A 15 ? ? -175.07 118.86 153 19 SER A 20 ? ? -48.93 107.62 154 19 CYS A 59 ? ? -59.96 170.88 155 19 SER A 65 ? ? -38.77 -37.16 156 19 HIS A 101 ? ? -37.59 -38.84 157 19 SER A 123 ? ? -36.34 113.52 158 20 SER A 5 ? ? -83.38 44.62 159 20 SER A 15 ? ? -175.59 114.68 160 20 SER A 61 ? ? -34.97 -34.41 161 20 SER A 123 ? ? -38.57 120.95 162 20 LYS A 124 ? ? -101.44 -64.30 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #