data_1WJZ # _entry.id 1WJZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WJZ pdb_00001wjz 10.2210/pdb1wjz/pdb RCSB RCSB023659 ? ? WWPDB D_1000023659 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmk001003857.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WJZ _pdbx_database_status.recvd_initial_deposition_date 2004-05-29 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kobayashi, N.' 1 'Koshiba, S.' 2 'Inoue, M.' 3 'Tochio, N.' 4 'Tomizawa, T.' 5 'Kigawa, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Soluiotn structure of J-domain of mouse DnaJ like protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kobayashi, N.' 1 ? primary 'Koshiba, S.' 2 ? primary 'Inoue, M.' 3 ? primary 'Tochio, N.' 4 ? primary 'Tomizawa, T.' 5 ? primary 'Kigawa, T.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description '1700030A21Rik protein' _entity.formula_weight 10455.798 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment J-domain _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DnaJ like protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGMALEQTLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWKILGNEET KKKYDLQRSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGMALEQTLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWKILGNEET KKKYDLQRSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmk001003857.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 MET n 1 9 ALA n 1 10 LEU n 1 11 GLU n 1 12 GLN n 1 13 THR n 1 14 LEU n 1 15 LYS n 1 16 LYS n 1 17 ASP n 1 18 TRP n 1 19 TYR n 1 20 SER n 1 21 ILE n 1 22 LEU n 1 23 GLY n 1 24 ALA n 1 25 ASP n 1 26 PRO n 1 27 SER n 1 28 ALA n 1 29 ASN n 1 30 MET n 1 31 SER n 1 32 ASP n 1 33 LEU n 1 34 LYS n 1 35 GLN n 1 36 LYS n 1 37 TYR n 1 38 GLN n 1 39 LYS n 1 40 LEU n 1 41 ILE n 1 42 LEU n 1 43 LEU n 1 44 TYR n 1 45 HIS n 1 46 PRO n 1 47 ASP n 1 48 LYS n 1 49 GLN n 1 50 SER n 1 51 ALA n 1 52 ASP n 1 53 VAL n 1 54 PRO n 1 55 ALA n 1 56 GLY n 1 57 THR n 1 58 MET n 1 59 GLU n 1 60 GLU n 1 61 CYS n 1 62 MET n 1 63 GLN n 1 64 LYS n 1 65 PHE n 1 66 ILE n 1 67 GLU n 1 68 ILE n 1 69 ASP n 1 70 GLN n 1 71 ALA n 1 72 TRP n 1 73 LYS n 1 74 ILE n 1 75 LEU n 1 76 GLY n 1 77 ASN n 1 78 GLU n 1 79 GLU n 1 80 THR n 1 81 LYS n 1 82 LYS n 1 83 LYS n 1 84 TYR n 1 85 ASP n 1 86 LEU n 1 87 GLN n 1 88 ARG n 1 89 SER n 1 90 GLY n 1 91 PRO n 1 92 SER n 1 93 SER n 1 94 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene 'RIKEN cDNA 1700030A21' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P030324-95 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZCSL3_MOUSE _struct_ref.pdbx_db_accession Q91ZF0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MALEQTLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWKILGNEETKKKYDLQ R ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WJZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 88 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q91ZF0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 81 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 88 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WJZ GLY A 1 ? UNP Q91ZF0 ? ? 'cloning artifact' 1 1 1 1WJZ SER A 2 ? UNP Q91ZF0 ? ? 'cloning artifact' 2 2 1 1WJZ SER A 3 ? UNP Q91ZF0 ? ? 'cloning artifact' 3 3 1 1WJZ GLY A 4 ? UNP Q91ZF0 ? ? 'cloning artifact' 4 4 1 1WJZ SER A 5 ? UNP Q91ZF0 ? ? 'cloning artifact' 5 5 1 1WJZ SER A 6 ? UNP Q91ZF0 ? ? 'cloning artifact' 6 6 1 1WJZ GLY A 7 ? UNP Q91ZF0 ? ? 'cloning artifact' 7 7 1 1WJZ SER A 89 ? UNP Q91ZF0 ? ? 'cloning artifact' 89 8 1 1WJZ GLY A 90 ? UNP Q91ZF0 ? ? 'cloning artifact' 90 9 1 1WJZ PRO A 91 ? UNP Q91ZF0 ? ? 'cloning artifact' 91 10 1 1WJZ SER A 92 ? UNP Q91ZF0 ? ? 'cloning artifact' 92 11 1 1WJZ SER A 93 ? UNP Q91ZF0 ? ? 'cloning artifact' 93 12 1 1WJZ GLY A 94 ? UNP Q91ZF0 ? ? 'cloning artifact' 94 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.07mM J-domain of DnaJ like protein U-13C,15N; 20mM Phosphate buffer Na (pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 # _pdbx_nmr_refine.entry_id 1WJZ _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1WJZ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WJZ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 NMRPipe 20020425 processing 'Delaglio, F.' 2 NMRView 5.0.4 'data analysis' 'Johnson, B. A.' 3 KUJIRA 0.901 'data analysis' 'Kobayashi, N.' 4 CYANA 2.0.17 'structure solution' 'Guentert, P.' 5 CYANA 2.0.17 refinement 'Guentert, P.' 6 # _exptl.entry_id 1WJZ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1WJZ _struct.title 'Soluiotn structure of J-domain of mouse DnaJ like protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WJZ _struct_keywords.pdbx_keywords CHAPERONE _struct_keywords.text 'J-domain, DnaJ like protein, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CHAPERONE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 17 ? LEU A 22 ? ASP A 17 LEU A 22 1 ? 6 HELX_P HELX_P2 2 ASN A 29 ? LEU A 40 ? ASN A 29 LEU A 40 1 ? 12 HELX_P HELX_P3 3 PRO A 54 ? GLY A 76 ? PRO A 54 GLY A 76 1 ? 23 HELX_P HELX_P4 4 GLU A 79 ? ARG A 88 ? GLU A 79 ARG A 88 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1WJZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WJZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 TRP 18 18 18 TRP TRP A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 MET 58 58 58 MET MET A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 TRP 72 72 72 TRP TRP A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 GLY 94 94 94 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-11-29 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -59.29 104.61 2 1 GLU A 11 ? ? 36.19 44.52 3 1 LYS A 48 ? ? -93.93 47.28 4 1 ASP A 52 ? ? -94.92 31.91 5 1 PRO A 54 ? ? -69.69 -177.11 6 1 PRO A 91 ? ? -69.78 0.28 7 2 LEU A 10 ? ? -86.48 48.37 8 2 PRO A 54 ? ? -69.69 -166.88 9 2 ILE A 74 ? ? -91.43 -61.10 10 3 SER A 5 ? ? -64.81 90.48 11 3 GLU A 11 ? ? -106.02 47.21 12 3 LYS A 48 ? ? -83.12 37.22 13 3 ALA A 51 ? ? -38.08 -28.47 14 3 PRO A 54 ? ? -69.74 -169.48 15 3 LEU A 75 ? ? -97.79 31.41 16 3 PRO A 91 ? ? -69.78 1.32 17 4 SER A 5 ? ? -88.42 38.07 18 4 TYR A 44 ? ? -103.88 41.53 19 4 LYS A 48 ? ? -93.74 47.94 20 5 GLN A 49 ? ? -45.77 171.09 21 5 PRO A 54 ? ? -69.79 -165.04 22 5 MET A 62 ? ? -56.18 -70.75 23 5 GLU A 79 ? ? -62.33 -70.06 24 5 ARG A 88 ? ? -42.97 157.89 25 6 THR A 13 ? ? -132.92 -50.26 26 6 LYS A 15 ? ? -38.03 -30.44 27 6 LYS A 48 ? ? -89.17 46.74 28 6 GLN A 63 ? ? -34.13 -36.57 29 7 SER A 3 ? ? -106.25 45.53 30 7 SER A 5 ? ? 38.03 47.83 31 7 GLU A 11 ? ? -88.26 48.66 32 7 LYS A 15 ? ? -122.44 -50.49 33 7 ALA A 28 ? ? -69.07 -179.52 34 7 LYS A 48 ? ? -77.45 46.70 35 7 ALA A 51 ? ? -35.42 -38.37 36 7 PRO A 54 ? ? -69.76 -170.43 37 7 LYS A 64 ? ? -52.47 -70.78 38 7 SER A 92 ? ? -48.41 153.17 39 8 SER A 2 ? ? -100.22 40.18 40 8 MET A 8 ? ? -44.34 166.19 41 8 GLN A 12 ? ? -106.60 45.29 42 8 LYS A 15 ? ? -130.93 -49.62 43 8 ASP A 32 ? ? -57.71 -71.08 44 8 LYS A 48 ? ? -77.54 49.18 45 8 SER A 93 ? ? -51.26 109.37 46 9 ALA A 9 ? ? -96.95 40.55 47 9 PRO A 91 ? ? -69.79 98.26 48 10 LYS A 16 ? ? -59.51 103.00 49 10 ASP A 17 ? ? -66.10 86.70 50 10 GLN A 49 ? ? -42.01 162.93 51 10 PRO A 54 ? ? -69.77 -164.05 52 10 MET A 62 ? ? -69.20 -70.35 53 10 GLN A 63 ? ? -36.77 -31.77 54 11 SER A 6 ? ? -80.92 42.27 55 11 THR A 13 ? ? -127.71 -57.77 56 11 LYS A 16 ? ? -66.92 91.38 57 11 GLN A 49 ? ? -46.15 159.30 58 11 ILE A 74 ? ? -96.06 -72.41 59 12 SER A 2 ? ? 71.22 43.00 60 12 GLU A 11 ? ? -94.04 40.02 61 12 LYS A 48 ? ? -75.68 48.58 62 12 LEU A 75 ? ? -84.52 33.56 63 12 GLU A 79 ? ? -84.65 -74.24 64 12 ARG A 88 ? ? -34.51 130.29 65 12 PRO A 91 ? ? -69.75 2.87 66 12 SER A 92 ? ? -169.75 105.49 67 13 SER A 5 ? ? -36.81 132.95 68 13 MET A 8 ? ? 34.84 47.02 69 13 GLN A 49 ? ? -45.94 172.34 70 13 PRO A 54 ? ? -69.77 -165.37 71 13 LYS A 81 ? ? -39.03 -35.93 72 13 ARG A 88 ? ? -39.28 123.06 73 14 SER A 3 ? ? -173.90 122.55 74 14 HIS A 45 ? ? -38.11 140.26 75 14 LYS A 48 ? ? -86.69 45.58 76 15 GLN A 49 ? ? -52.25 -175.41 77 15 PRO A 54 ? ? -69.75 -171.53 78 15 ARG A 88 ? ? -46.45 103.55 79 16 MET A 8 ? ? 37.58 28.51 80 16 ALA A 28 ? ? -66.42 -177.24 81 16 PRO A 54 ? ? -69.75 -166.65 82 16 GLU A 79 ? ? -79.99 -70.36 83 16 SER A 89 ? ? -89.97 45.59 84 17 SER A 5 ? ? -47.44 165.04 85 17 MET A 8 ? ? -43.18 103.38 86 17 ASP A 17 ? ? -59.87 109.44 87 17 ASP A 32 ? ? -78.53 -74.27 88 17 LYS A 48 ? ? -80.16 44.32 89 17 ALA A 51 ? ? -33.91 -38.16 90 17 PRO A 54 ? ? -69.71 -174.06 91 17 MET A 62 ? ? -59.98 -71.17 92 17 PRO A 91 ? ? -69.73 2.21 93 17 SER A 92 ? ? 72.50 43.07 94 18 GLU A 11 ? ? 39.64 28.86 95 18 LYS A 15 ? ? -131.68 -47.94 96 18 GLN A 49 ? ? -38.72 158.23 97 18 ALA A 51 ? ? -38.91 -26.53 98 18 PRO A 54 ? ? -69.79 -165.41 99 18 LEU A 75 ? ? -85.87 34.69 100 18 ARG A 88 ? ? -68.52 -179.27 101 18 SER A 89 ? ? 34.50 45.50 102 18 PRO A 91 ? ? -69.73 89.94 103 19 ASP A 32 ? ? -47.18 -72.09 104 19 TYR A 44 ? ? -105.73 40.66 105 19 GLN A 49 ? ? -48.25 172.47 106 19 PRO A 54 ? ? -69.81 -172.29 107 19 ARG A 88 ? ? -56.93 -177.26 108 19 SER A 89 ? ? -125.13 -59.18 109 19 SER A 92 ? ? -68.57 74.82 110 19 SER A 93 ? ? -167.32 106.36 111 20 SER A 31 ? ? -49.44 -70.75 112 20 LYS A 48 ? ? -87.99 37.34 113 20 PRO A 54 ? ? -69.72 -167.45 114 20 ARG A 88 ? ? -36.20 150.16 #