data_1WTU # _entry.id 1WTU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WTU pdb_00001wtu 10.2210/pdb1wtu/pdb WWPDB D_1000177234 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WTU _pdbx_database_status.recvd_initial_deposition_date 1996-07-29 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jia, X.' 1 'Grove, A.' 2 'Ivancic, M.' 3 'Hsu, V.L.' 4 'Geiduschek, E.P.' 5 'Kearns, D.R.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure of the Bacillus subtilis phage SPO1-encoded type II DNA-binding protein TF1 in solution.' J.Mol.Biol. 263 259 268 1996 JMOBAK UK 0022-2836 0070 ? 8913305 10.1006/jmbi.1996.0573 1 ;Proton and Nitrogen NMR Sequence-Specific Assignments and Secondary Structure Determination of the Bacillus Subtilis Spo1-Encoded Transcription Factor 1 ; Biochemistry 33 8842 ? 1994 BICHAW US 0006-2960 0033 ? ? ? 2 '3-A Resolution Structure of a Protein with Histone-Like Properties in Prokaryotes' Nature 310 376 ? 1984 NATUAS UK 0028-0836 0006 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jia, X.' 1 ? primary 'Grove, A.' 2 ? primary 'Ivancic, M.' 3 ? primary 'Hsu, V.L.' 4 ? primary 'Geiduscheck, E.P.' 5 ? primary 'Kearns, D.R.' 6 ? 1 'Jia, X.' 7 ? 1 'Reisman, J.M.' 8 ? 1 'Hsu, V.L.' 9 ? 1 'Geiduschek, E.P.' 10 ? 1 'Parello, J.' 11 ? 1 'Kearns, D.R.' 12 ? 2 'Tanaka, I.' 13 ? 2 'Appelt, K.' 14 ? 2 'Dijk, J.' 15 ? 2 'White, S.W.' 16 ? 2 'Wilson, K.S.' 17 ? # _cell.entry_id 1WTU _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1WTU _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'TRANSCRIPTION FACTOR 1' _entity.formula_weight 10752.391 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'THIS PROTEIN IS THE BACILLUS SUBTILIS PHAGE SPO1-ENCODED TYPE II DNA-BINDING PROTEIN' # _entity_name_com.entity_id 1 _entity_name_com.name TF1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNKTELIKAIAQDTELTQVSVSKMLASFEKITTETVAKGDKVQLTGFLNIKPVARQARKGFNPQTQEALEIAPSVGVSVK PGESLKKAAEGLKYEDFAK ; _entity_poly.pdbx_seq_one_letter_code_can ;MNKTELIKAIAQDTELTQVSVSKMLASFEKITTETVAKGDKVQLTGFLNIKPVARQARKGFNPQTQEALEIAPSVGVSVK PGESLKKAAEGLKYEDFAK ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 LYS n 1 4 THR n 1 5 GLU n 1 6 LEU n 1 7 ILE n 1 8 LYS n 1 9 ALA n 1 10 ILE n 1 11 ALA n 1 12 GLN n 1 13 ASP n 1 14 THR n 1 15 GLU n 1 16 LEU n 1 17 THR n 1 18 GLN n 1 19 VAL n 1 20 SER n 1 21 VAL n 1 22 SER n 1 23 LYS n 1 24 MET n 1 25 LEU n 1 26 ALA n 1 27 SER n 1 28 PHE n 1 29 GLU n 1 30 LYS n 1 31 ILE n 1 32 THR n 1 33 THR n 1 34 GLU n 1 35 THR n 1 36 VAL n 1 37 ALA n 1 38 LYS n 1 39 GLY n 1 40 ASP n 1 41 LYS n 1 42 VAL n 1 43 GLN n 1 44 LEU n 1 45 THR n 1 46 GLY n 1 47 PHE n 1 48 LEU n 1 49 ASN n 1 50 ILE n 1 51 LYS n 1 52 PRO n 1 53 VAL n 1 54 ALA n 1 55 ARG n 1 56 GLN n 1 57 ALA n 1 58 ARG n 1 59 LYS n 1 60 GLY n 1 61 PHE n 1 62 ASN n 1 63 PRO n 1 64 GLN n 1 65 THR n 1 66 GLN n 1 67 GLU n 1 68 ALA n 1 69 LEU n 1 70 GLU n 1 71 ILE n 1 72 ALA n 1 73 PRO n 1 74 SER n 1 75 VAL n 1 76 GLY n 1 77 VAL n 1 78 SER n 1 79 VAL n 1 80 LYS n 1 81 PRO n 1 82 GLY n 1 83 GLU n 1 84 SER n 1 85 LEU n 1 86 LYS n 1 87 LYS n 1 88 ALA n 1 89 ALA n 1 90 GLU n 1 91 GLY n 1 92 LEU n 1 93 LYS n 1 94 TYR n 1 95 GLU n 1 96 ASP n 1 97 PHE n 1 98 ALA n 1 99 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus 'SPO1-like viruses' _entity_src_gen.pdbx_gene_src_gene TF1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus phage SPO1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10685 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene TF1 _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PKJB842 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TF1_BPSP1 _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P04445 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MNKTELIKAIAQDTELTQVSVSKMLASFEKITTETVAKGDKVQLTGFLNIKPVARQARKGFNPQTQEALEIAPSVGVSVK PGESLKKAAEGLKYEDFAK ; _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1WTU A 1 ? 99 ? P04445 1 ? 99 ? 1 99 2 1 1WTU B 1 ? 99 ? P04445 1 ? 99 ? 1 99 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1WTU _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1WTU _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1WTU _struct.title 'TRANSCRIPTION FACTOR 1, NMR, MINIMIZED AVERAGE STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WTU _struct_keywords.pdbx_keywords 'TRANSCRIPTION FACTOR' _struct_keywords.text 'TRANSCRIPTION FACTOR, TYPE II DNA-BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 3 ? GLN A 12 ? LYS A 3 GLN A 12 1 ? 10 HELX_P HELX_P2 2 GLN A 18 ? GLY A 39 ? GLN A 18 GLY A 39 1 ? 22 HELX_P HELX_P3 3 GLU A 83 ? GLU A 90 ? GLU A 83 GLU A 90 1 ? 8 HELX_P HELX_P4 4 LYS A 93 ? ASP A 96 ? LYS A 93 ASP A 96 1 ? 4 HELX_P HELX_P5 5 LYS B 3 ? GLN B 12 ? LYS B 3 GLN B 12 1 ? 10 HELX_P HELX_P6 6 GLN B 18 ? GLY B 39 ? GLN B 18 GLY B 39 1 ? 22 HELX_P HELX_P7 7 SER B 84 ? ALA B 89 ? SER B 84 ALA B 89 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASN A 49 ? PRO A 52 ? ASN A 49 PRO A 52 A 2 VAL A 77 ? LYS A 80 ? VAL A 77 LYS A 80 B 1 ASN B 49 ? VAL B 53 ? ASN B 49 VAL B 53 B 2 GLY B 76 ? LYS B 80 ? GLY B 76 LYS B 80 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ASN A 49 ? O ASN A 49 N LYS A 80 ? N LYS A 80 B 1 2 O ASN B 49 ? O ASN B 49 N LYS B 80 ? N LYS B 80 # _database_PDB_matrix.entry_id 1WTU _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WTU _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LYS 99 99 99 LYS LYS A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 ASN 2 2 2 ASN ASN B . n B 1 3 LYS 3 3 3 LYS LYS B . n B 1 4 THR 4 4 4 THR THR B . n B 1 5 GLU 5 5 5 GLU GLU B . n B 1 6 LEU 6 6 6 LEU LEU B . n B 1 7 ILE 7 7 7 ILE ILE B . n B 1 8 LYS 8 8 8 LYS LYS B . n B 1 9 ALA 9 9 9 ALA ALA B . n B 1 10 ILE 10 10 10 ILE ILE B . n B 1 11 ALA 11 11 11 ALA ALA B . n B 1 12 GLN 12 12 12 GLN GLN B . n B 1 13 ASP 13 13 13 ASP ASP B . n B 1 14 THR 14 14 14 THR THR B . n B 1 15 GLU 15 15 15 GLU GLU B . n B 1 16 LEU 16 16 16 LEU LEU B . n B 1 17 THR 17 17 17 THR THR B . n B 1 18 GLN 18 18 18 GLN GLN B . n B 1 19 VAL 19 19 19 VAL VAL B . n B 1 20 SER 20 20 20 SER SER B . n B 1 21 VAL 21 21 21 VAL VAL B . n B 1 22 SER 22 22 22 SER SER B . n B 1 23 LYS 23 23 23 LYS LYS B . n B 1 24 MET 24 24 24 MET MET B . n B 1 25 LEU 25 25 25 LEU LEU B . n B 1 26 ALA 26 26 26 ALA ALA B . n B 1 27 SER 27 27 27 SER SER B . n B 1 28 PHE 28 28 28 PHE PHE B . n B 1 29 GLU 29 29 29 GLU GLU B . n B 1 30 LYS 30 30 30 LYS LYS B . n B 1 31 ILE 31 31 31 ILE ILE B . n B 1 32 THR 32 32 32 THR THR B . n B 1 33 THR 33 33 33 THR THR B . n B 1 34 GLU 34 34 34 GLU GLU B . n B 1 35 THR 35 35 35 THR THR B . n B 1 36 VAL 36 36 36 VAL VAL B . n B 1 37 ALA 37 37 37 ALA ALA B . n B 1 38 LYS 38 38 38 LYS LYS B . n B 1 39 GLY 39 39 39 GLY GLY B . n B 1 40 ASP 40 40 40 ASP ASP B . n B 1 41 LYS 41 41 41 LYS LYS B . n B 1 42 VAL 42 42 42 VAL VAL B . n B 1 43 GLN 43 43 43 GLN GLN B . n B 1 44 LEU 44 44 44 LEU LEU B . n B 1 45 THR 45 45 45 THR THR B . n B 1 46 GLY 46 46 46 GLY GLY B . n B 1 47 PHE 47 47 47 PHE PHE B . n B 1 48 LEU 48 48 48 LEU LEU B . n B 1 49 ASN 49 49 49 ASN ASN B . n B 1 50 ILE 50 50 50 ILE ILE B . n B 1 51 LYS 51 51 51 LYS LYS B . n B 1 52 PRO 52 52 52 PRO PRO B . n B 1 53 VAL 53 53 53 VAL VAL B . n B 1 54 ALA 54 54 54 ALA ALA B . n B 1 55 ARG 55 55 55 ARG ARG B . n B 1 56 GLN 56 56 56 GLN GLN B . n B 1 57 ALA 57 57 57 ALA ALA B . n B 1 58 ARG 58 58 58 ARG ARG B . n B 1 59 LYS 59 59 59 LYS LYS B . n B 1 60 GLY 60 60 60 GLY GLY B . n B 1 61 PHE 61 61 61 PHE PHE B . n B 1 62 ASN 62 62 62 ASN ASN B . n B 1 63 PRO 63 63 63 PRO PRO B . n B 1 64 GLN 64 64 64 GLN GLN B . n B 1 65 THR 65 65 65 THR THR B . n B 1 66 GLN 66 66 66 GLN GLN B . n B 1 67 GLU 67 67 67 GLU GLU B . n B 1 68 ALA 68 68 68 ALA ALA B . n B 1 69 LEU 69 69 69 LEU LEU B . n B 1 70 GLU 70 70 70 GLU GLU B . n B 1 71 ILE 71 71 71 ILE ILE B . n B 1 72 ALA 72 72 72 ALA ALA B . n B 1 73 PRO 73 73 73 PRO PRO B . n B 1 74 SER 74 74 74 SER SER B . n B 1 75 VAL 75 75 75 VAL VAL B . n B 1 76 GLY 76 76 76 GLY GLY B . n B 1 77 VAL 77 77 77 VAL VAL B . n B 1 78 SER 78 78 78 SER SER B . n B 1 79 VAL 79 79 79 VAL VAL B . n B 1 80 LYS 80 80 80 LYS LYS B . n B 1 81 PRO 81 81 81 PRO PRO B . n B 1 82 GLY 82 82 82 GLY GLY B . n B 1 83 GLU 83 83 83 GLU GLU B . n B 1 84 SER 84 84 84 SER SER B . n B 1 85 LEU 85 85 85 LEU LEU B . n B 1 86 LYS 86 86 86 LYS LYS B . n B 1 87 LYS 87 87 87 LYS LYS B . n B 1 88 ALA 88 88 88 ALA ALA B . n B 1 89 ALA 89 89 89 ALA ALA B . n B 1 90 GLU 90 90 90 GLU GLU B . n B 1 91 GLY 91 91 91 GLY GLY B . n B 1 92 LEU 92 92 92 LEU LEU B . n B 1 93 LYS 93 93 93 LYS LYS B . n B 1 94 TYR 94 94 94 TYR TYR B . n B 1 95 GLU 95 95 95 GLU GLU B . n B 1 96 ASP 96 96 96 ASP ASP B . n B 1 97 PHE 97 97 97 PHE PHE B . n B 1 98 ALA 98 98 98 ALA ALA B . n B 1 99 LYS 99 99 99 LYS LYS B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-02-12 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 N A SER 74 ? ? CA A SER 74 ? ? CB A SER 74 ? ? 98.80 110.50 -11.70 1.50 N 2 1 CB A TYR 94 ? ? CG A TYR 94 ? ? CD2 A TYR 94 ? ? 113.99 121.00 -7.01 0.60 N 3 1 CB A TYR 94 ? ? CG A TYR 94 ? ? CD1 A TYR 94 ? ? 115.82 121.00 -5.18 0.60 N 4 1 CB A PHE 97 ? ? CG A PHE 97 ? ? CD1 A PHE 97 ? ? 115.21 120.80 -5.59 0.70 N 5 1 C B ASN 62 ? ? N B PRO 63 ? ? CD B PRO 63 ? ? 114.84 128.40 -13.56 2.10 Y 6 1 C B ALA 72 ? ? N B PRO 73 ? ? CD B PRO 73 ? ? 114.66 128.40 -13.74 2.10 Y 7 1 CB B TYR 94 ? ? CG B TYR 94 ? ? CD2 B TYR 94 ? ? 116.42 121.00 -4.58 0.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 2 ? ? 63.41 -90.62 2 1 ASP A 13 ? ? -109.98 -80.21 3 1 LEU A 16 ? ? -6.46 -61.48 4 1 THR A 33 ? ? -26.77 -52.71 5 1 THR A 35 ? ? -59.36 -75.80 6 1 ALA A 37 ? ? -46.63 -74.02 7 1 ASP A 40 ? ? -27.15 -54.85 8 1 LYS A 41 ? ? -43.00 105.70 9 1 THR A 45 ? ? 34.99 50.43 10 1 PHE A 47 ? ? -136.40 -51.62 11 1 LYS A 51 ? ? -163.12 108.84 12 1 ARG A 55 ? ? -165.43 85.36 13 1 GLN A 56 ? ? -135.44 -51.11 14 1 ALA A 57 ? ? 55.16 102.17 15 1 ARG A 58 ? ? 177.04 97.83 16 1 LYS A 59 ? ? -75.25 -93.68 17 1 ASN A 62 ? ? 163.90 172.84 18 1 GLN A 64 ? ? -157.31 -80.47 19 1 GLN A 66 ? ? 131.25 30.85 20 1 GLU A 67 ? ? 40.94 86.16 21 1 ALA A 68 ? ? -172.35 -87.57 22 1 LEU A 69 ? ? 80.21 -81.17 23 1 GLU A 70 ? ? -121.28 -112.13 24 1 VAL A 75 ? ? 172.29 154.67 25 1 GLU A 83 ? ? -33.41 -25.49 26 1 ALA A 89 ? ? -66.53 10.72 27 1 ASN B 2 ? ? -137.56 -84.39 28 1 ASP B 13 ? ? -109.98 -80.65 29 1 THR B 14 ? ? -74.15 -165.34 30 1 GLU B 15 ? ? 49.84 19.43 31 1 LEU B 16 ? ? -23.51 -47.10 32 1 THR B 35 ? ? -53.59 -82.57 33 1 ASP B 40 ? ? -19.78 -71.91 34 1 LYS B 41 ? ? -29.78 113.89 35 1 PHE B 47 ? ? -132.70 -42.04 36 1 LYS B 51 ? ? -156.55 88.82 37 1 ARG B 55 ? ? -153.63 72.70 38 1 GLN B 56 ? ? 28.53 -165.06 39 1 LYS B 59 ? ? 39.37 98.99 40 1 ASN B 62 ? ? 165.44 -159.47 41 1 GLN B 64 ? ? -175.70 -61.66 42 1 GLN B 66 ? ? 1.18 130.75 43 1 GLU B 67 ? ? 0.02 93.42 44 1 ALA B 68 ? ? -163.37 -106.96 45 1 LEU B 69 ? ? 56.65 175.46 46 1 GLU B 70 ? ? -110.96 63.41 47 1 ALA B 72 ? ? -176.85 -38.95 48 1 SER B 74 ? ? 56.93 -156.23 49 1 VAL B 75 ? ? -130.34 -48.31 50 1 PRO B 81 ? ? -99.71 -158.86 51 1 GLU B 83 ? ? 38.59 -79.80 52 1 GLU B 90 ? ? -46.74 -70.56 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 ALA B 54 ? ? ARG B 55 ? ? 138.50 2 1 PHE B 61 ? ? ASN B 62 ? ? -144.98 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 TYR A 94 ? ? 12.31 2 1 ALA B 54 ? ? -11.83 3 1 ARG B 55 ? ? -10.49 4 1 PHE B 61 ? ? 13.54 5 1 TYR B 94 ? ? 10.26 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 55 ? ? 0.222 'SIDE CHAIN' 2 1 ARG A 58 ? ? 0.268 'SIDE CHAIN' 3 1 TYR A 94 ? ? 0.223 'SIDE CHAIN' 4 1 PHE A 97 ? ? 0.129 'SIDE CHAIN' 5 1 ARG B 55 ? ? 0.315 'SIDE CHAIN' 6 1 ARG B 58 ? ? 0.228 'SIDE CHAIN' 7 1 TYR B 94 ? ? 0.137 'SIDE CHAIN' #