data_1WVO # _entry.id 1WVO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WVO pdb_00001wvo 10.2210/pdb1wvo/pdb RCSB RCSB024056 ? ? WWPDB D_1000024056 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001002155.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WVO _pdbx_database_status.recvd_initial_deposition_date 2004-12-22 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ito, Y.' 1 'Hamada, T.' 2 'Hayashi, F.' 3 'Yokoyama, S.' 4 'Hirota, H.' 5 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 6 # _citation.id primary _citation.title 'Solution structure of the antifreeze-like domain of human sialic acid synthase' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 15 _citation.page_first 1010 _citation.page_last 1016 _citation.year 2006 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16597820 _citation.pdbx_database_id_DOI 10.1110/ps.051700406 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hamada, T.' 1 ? primary 'Ito, Y.' 2 ? primary 'Abe, T.' 3 ? primary 'Hayashi, F.' 4 ? primary 'Guntert, P.' 5 ? primary 'Inoue, M.' 6 ? primary 'Kigawa, T.' 7 ? primary 'Terada, T.' 8 ? primary 'Shirouzu, M.' 9 ? primary 'Yoshida, M.' 10 ? primary 'Tanaka, A.' 11 ? primary 'Sugano, S.' 12 ? primary 'Yokoyama, S.' 13 ? primary 'Hirota, H.' 14 ? # _cell.entry_id 1WVO _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1WVO _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Sialic acid synthase' _entity.formula_weight 8269.431 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec '2.5.1.56, 2.5.1.57' _entity.pdbx_mutation ? _entity.pdbx_fragment 'antifreeze protein like domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;N-acetylneuraminate synthase, N-acetylneuraminic acid synthase, N-acetylneuraminate-9-phosphate synthase, N-acetylneuraminic acid phosphate synthase ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKSSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKSSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001002155.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 VAL n 1 10 VAL n 1 11 ALA n 1 12 LYS n 1 13 VAL n 1 14 LYS n 1 15 ILE n 1 16 PRO n 1 17 GLU n 1 18 GLY n 1 19 THR n 1 20 ILE n 1 21 LEU n 1 22 THR n 1 23 MET n 1 24 ASP n 1 25 MET n 1 26 LEU n 1 27 THR n 1 28 VAL n 1 29 LYS n 1 30 VAL n 1 31 GLY n 1 32 GLU n 1 33 PRO n 1 34 LYS n 1 35 GLY n 1 36 TYR n 1 37 PRO n 1 38 PRO n 1 39 GLU n 1 40 ASP n 1 41 ILE n 1 42 PHE n 1 43 ASN n 1 44 LEU n 1 45 VAL n 1 46 GLY n 1 47 LYS n 1 48 LYS n 1 49 VAL n 1 50 LEU n 1 51 VAL n 1 52 THR n 1 53 VAL n 1 54 GLU n 1 55 GLU n 1 56 ASP n 1 57 ASP n 1 58 THR n 1 59 ILE n 1 60 MET n 1 61 GLU n 1 62 GLU n 1 63 LEU n 1 64 VAL n 1 65 ASP n 1 66 ASN n 1 67 HIS n 1 68 GLY n 1 69 LYS n 1 70 LYS n 1 71 ILE n 1 72 LYS n 1 73 SER n 1 74 SER n 1 75 GLY n 1 76 PRO n 1 77 SER n 1 78 SER n 1 79 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040531-08 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SIAS_HUMAN _struct_ref.pdbx_db_accession Q9NR45 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS _struct_ref.pdbx_align_begin 294 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1WVO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 73 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NR45 _struct_ref_seq.db_align_beg 294 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 359 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 73 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1WVO GLY A 1 ? UNP Q9NR45 ? ? 'cloning artifact' 1 1 1 1WVO SER A 2 ? UNP Q9NR45 ? ? 'cloning artifact' 2 2 1 1WVO SER A 3 ? UNP Q9NR45 ? ? 'cloning artifact' 3 3 1 1WVO GLY A 4 ? UNP Q9NR45 ? ? 'cloning artifact' 4 4 1 1WVO SER A 5 ? UNP Q9NR45 ? ? 'cloning artifact' 5 5 1 1WVO SER A 6 ? UNP Q9NR45 ? ? 'cloning artifact' 6 6 1 1WVO GLY A 7 ? UNP Q9NR45 ? ? 'cloning artifact' 7 7 1 1WVO SER A 74 ? UNP Q9NR45 ? ? 'cloning artifact' 74 8 1 1WVO GLY A 75 ? UNP Q9NR45 ? ? 'cloning artifact' 75 9 1 1WVO PRO A 76 ? UNP Q9NR45 ? ? 'cloning artifact' 76 10 1 1WVO SER A 77 ? UNP Q9NR45 ? ? 'cloning artifact' 77 11 1 1WVO SER A 78 ? UNP Q9NR45 ? ? 'cloning artifact' 78 12 1 1WVO GLY A 79 ? UNP Q9NR45 ? ? 'cloning artifact' 79 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_13C-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.1mM antifreeze protein like domain U-15N,13C; 20mM Tris-HCl buffer (pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 600 2 ? Varian INOVA 800 # _pdbx_nmr_refine.entry_id 1WVO _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1WVO _pdbx_nmr_details.text 'This structure was determined using 3D NMR techniques' # _pdbx_nmr_ensemble.entry_id 1WVO _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function,structures with the lowest energy,structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WVO _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR 6.1c collection Varian 1 NMRPipe 21_2 collection 'Delaglio, F.' 2 NMRView 5.0.4 'data analysis' 'Johnson, B. A.' 3 KUJIRA 0.9049 'structure solution' 'Kobayashi, N.' 4 CYANA 2.0.17 'structure solution' 'Guentert, P.' 5 CYANA 2.0.17 refinement 'Guentert, P.' 6 OPALp 1.4 refinement 'KORADI, R., BILLETER, M., GUNTERT, P.' 7 # _exptl.entry_id 1WVO _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1WVO _struct.title 'Solution structure of RSGI RUH-029, an antifreeze protein like domain in human N-acetylneuraminic acid phosphate synthase gene.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WVO _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;Antifreeze protein like domain, N-Acetylneuraminic acid phosphate synthase, Structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 22 ? ASP A 24 ? THR A 22 ASP A 24 5 ? 3 HELX_P HELX_P2 2 ASP A 40 ? VAL A 45 ? ASP A 40 VAL A 45 1 ? 6 HELX_P HELX_P3 3 MET A 60 ? VAL A 64 ? MET A 60 VAL A 64 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 8 ? ALA A 11 ? SER A 8 ALA A 11 A 2 LEU A 26 ? LYS A 29 ? LEU A 26 LYS A 29 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id SER _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 8 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id SER _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 8 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 29 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 29 # _database_PDB_matrix.entry_id 1WVO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WVO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 GLY 79 79 79 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-01-03 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -75.04 41.00 2 1 PRO A 33 ? ? -80.47 44.02 3 1 VAL A 45 ? ? -67.20 93.73 4 1 ASP A 56 ? ? 56.92 13.06 5 1 LYS A 69 ? ? -99.14 -65.03 6 1 ILE A 71 ? ? -74.93 39.60 7 2 SER A 77 ? ? -104.30 -122.90 8 3 VAL A 30 ? ? -59.63 98.62 9 3 VAL A 45 ? ? -67.68 91.29 10 4 GLU A 62 ? ? -65.66 4.33 11 4 ASN A 66 ? ? 179.73 135.55 12 5 HIS A 67 ? ? 64.43 -67.28 13 5 LYS A 69 ? ? 154.68 -4.48 14 5 SER A 73 ? ? -62.40 92.87 15 5 SER A 78 ? ? -154.62 80.34 16 6 SER A 5 ? ? -140.79 24.92 17 6 VAL A 45 ? ? -60.78 98.70 18 7 SER A 2 ? ? -131.41 -67.12 19 7 SER A 5 ? ? -153.97 79.44 20 7 PRO A 33 ? ? -73.30 31.65 21 7 HIS A 67 ? ? -63.63 94.34 22 7 SER A 74 ? ? -170.23 -170.70 23 8 SER A 6 ? ? -102.83 -105.42 24 8 ASP A 56 ? ? 82.87 1.20 25 8 ASN A 66 ? ? 173.18 114.94 26 8 SER A 73 ? ? -75.47 -168.36 27 9 SER A 5 ? ? -161.46 -68.11 28 9 LYS A 70 ? ? -59.08 109.38 29 9 SER A 73 ? ? -78.60 -77.70 30 9 PRO A 76 ? ? -68.88 9.65 31 9 SER A 78 ? ? -169.92 -26.01 32 10 PRO A 33 ? ? -77.80 28.80 33 10 ASP A 56 ? ? 72.47 -6.18 34 10 ILE A 59 ? ? -67.26 93.73 35 11 SER A 5 ? ? -171.71 127.91 36 12 SER A 2 ? ? -148.32 -48.69 37 12 LYS A 34 ? ? -48.54 106.15 38 12 HIS A 67 ? ? -147.20 -55.72 39 12 LYS A 69 ? ? -135.58 -57.36 40 12 PRO A 76 ? ? -67.73 15.36 41 13 VAL A 30 ? ? -66.99 89.99 42 13 SER A 78 ? ? -79.12 -167.57 43 14 LYS A 34 ? ? -67.47 95.32 44 14 ASP A 56 ? ? 58.63 8.29 45 15 SER A 2 ? ? -54.09 -71.18 46 15 LYS A 70 ? ? -161.67 105.98 47 15 SER A 73 ? ? -123.38 -67.64 48 15 SER A 77 ? ? -73.79 48.86 49 16 PRO A 33 ? ? -73.82 36.23 50 16 VAL A 45 ? ? -68.05 99.19 51 16 LYS A 69 ? ? -125.89 -77.20 52 16 SER A 73 ? ? -57.40 104.43 53 17 ASP A 56 ? ? 69.63 -1.07 54 17 LYS A 69 ? ? -157.01 -24.91 55 17 SER A 77 ? ? -152.30 35.67 56 18 SER A 2 ? ? -67.99 -178.64 57 18 PRO A 33 ? ? -66.46 13.02 58 19 LYS A 69 ? ? -72.22 38.21 59 19 LYS A 72 ? ? -131.77 -78.32 60 20 SER A 6 ? ? 166.50 160.35 61 20 LYS A 34 ? ? -68.63 92.91 62 20 ASP A 56 ? ? 59.23 11.58 63 20 LYS A 69 ? ? -116.79 50.14 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 36 ? ? 0.066 'SIDE CHAIN' 2 10 TYR A 36 ? ? 0.071 'SIDE CHAIN' 3 11 TYR A 36 ? ? 0.070 'SIDE CHAIN' #