data_1WWE # _entry.id 1WWE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1WWE pdb_00001wwe 10.2210/pdb1wwe/pdb RCSB RCSB024079 ? ? WWPDB D_1000024079 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1WWD 'NMR Structure Determined for MLV NC Complex with RNA Sequence AACAGU' unspecified PDB 1WWF 'NMR Structure Determined for MLV NC Complex with RNA Sequence CCUCCGU' unspecified PDB 1WWG 'NMR Structure Determined for MLV NC Complex with RNA Sequence UAUCUG' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1WWE _pdbx_database_status.recvd_initial_deposition_date 2005-01-05 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dey, A.' 1 'York, D.' 2 'Smalls-Mantey, A.' 3 'Summers, M.F.' 4 # _citation.id primary _citation.title 'Composition and sequence-dependent binding of RNA to the nucleocapsid protein of Moloney murine leukemia virus(,)' _citation.journal_abbrev Biochemistry _citation.journal_volume 44 _citation.page_first 3735 _citation.page_last 3744 _citation.year 2005 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15751950 _citation.pdbx_database_id_DOI 10.1021/bi047639q # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dey, A.' 1 ? primary 'York, D.' 2 ? primary 'Smalls-Mantey, A.' 3 ? primary 'Summers, M.F.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn "5'-R(P*UP*UP*UP*UP*GP*CP*U)-3'" 2136.259 1 ? ? ? ? 2 polymer man 'Nucleoprotein p10' 6377.248 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 2 _entity_name_com.name 'Nucleocapsid Protein' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 polyribonucleotide no no UUUUGCU UUUUGCU B ? 2 'polypeptide(L)' no no ATVVSGQKQDRQGGERRRSQLDRDQCAYCKEKGHWAKDCPKKPRGPRGPRPQTSLL ATVVSGQKQDRQGGERRRSQLDRDQCAYCKEKGHWAKDCPKKPRGPRGPRPQTSLL A ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 U n 1 2 U n 1 3 U n 1 4 U n 1 5 G n 1 6 C n 1 7 U n 2 1 ALA n 2 2 THR n 2 3 VAL n 2 4 VAL n 2 5 SER n 2 6 GLY n 2 7 GLN n 2 8 LYS n 2 9 GLN n 2 10 ASP n 2 11 ARG n 2 12 GLN n 2 13 GLY n 2 14 GLY n 2 15 GLU n 2 16 ARG n 2 17 ARG n 2 18 ARG n 2 19 SER n 2 20 GLN n 2 21 LEU n 2 22 ASP n 2 23 ARG n 2 24 ASP n 2 25 GLN n 2 26 CYS n 2 27 ALA n 2 28 TYR n 2 29 CYS n 2 30 LYS n 2 31 GLU n 2 32 LYS n 2 33 GLY n 2 34 HIS n 2 35 TRP n 2 36 ALA n 2 37 LYS n 2 38 ASP n 2 39 CYS n 2 40 PRO n 2 41 LYS n 2 42 LYS n 2 43 PRO n 2 44 ARG n 2 45 GLY n 2 46 PRO n 2 47 ARG n 2 48 GLY n 2 49 PRO n 2 50 ARG n 2 51 PRO n 2 52 GLN n 2 53 THR n 2 54 SER n 2 55 LEU n 2 56 LEU n # _entity_src_gen.entity_id 2 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Gammaretrovirus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Murine leukemia virus' _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Moloney murine leukemia virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11801 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-6P-1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP GAG_MLVMO P03332 2 ATVVSGQKQDRQGGERRRSQLDRDQCAYCKEKGHWAKDCPKKPRGPRGPRPQTSLL 479 ? 2 PDB 1WWE 1WWE 1 ? ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1WWE A 1 ? 56 ? P03332 479 ? 534 ? 1 56 2 2 1WWE B 1 ? 7 ? 1WWE 517 ? 523 ? 517 523 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 C 'RNA linking' y "CYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O8 P' 323.197 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 G 'RNA linking' y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U 'RNA linking' y "URIDINE-5'-MONOPHOSPHATE" ? 'C9 H13 N2 O9 P' 324.181 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 2 1 '2D NOESY' 3 1 1 '2D TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 288 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '10mM Tris-HCl, pH 7.0, 10mM NaCl, 0.1mM ZnCl2' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 'Unlabelled RNA: 1mM RNA concentration, in 10mM Tris-HCl, pH 7.0, 10mM NaCl, 0.1mM ZnCl2, 0.1mM BME' '99.99% D2O' 2 'Unlabelled NC Protein: 1mM protein concentration, in 10mM Tris-HCl, pH 7.0, 10mM NaCl, 0.1mM ZnCl2, 0.1mM BME' '99.99% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AVANCE 800 2 ? Bruker DMX 600 # _pdbx_nmr_refine.entry_id 1WWE _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ;The structures are based on a total of following restraints for: RNA:35 intraresidue restraints,35 intermolecular NOE restraints and 12 inter-molecular H-Bond restraints; NC Protein: 22 intraresidue restraints and 40 H-Bond restraints ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1WWE _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques' # _pdbx_nmr_ensemble.entry_id 1WWE _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1WWE _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 6.0 collection Bruker 1 NMRPipe Current processing 'Delaglio, F. et.al' 2 CYANA ? refinement ? 3 # _exptl.entry_id 1WWE _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1WWE _struct.title 'NMR Structure Determined for MLV NC complex with RNA Sequence UUUUGCU' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1WWE _struct_keywords.pdbx_keywords 'Viral protein/RNA' _struct_keywords.text 'Hydrophobic Guanosine Binding Pocket, Viral protein-RNA COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id TRP _struct_conf.beg_label_asym_id B _struct_conf.beg_label_seq_id 35 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id CYS _struct_conf.end_label_asym_id B _struct_conf.end_label_seq_id 39 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id TRP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 35 _struct_conf.end_auth_comp_id CYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 39 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? B CYS 26 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 26 A ZN 57 1_555 ? ? ? ? ? ? ? 2.312 ? ? metalc2 metalc ? ? B CYS 29 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 29 A ZN 57 1_555 ? ? ? ? ? ? ? 2.310 ? ? metalc3 metalc ? ? B HIS 34 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 34 A ZN 57 1_555 ? ? ? ? ? ? ? 1.985 ? ? metalc4 metalc ? ? B CYS 39 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 39 A ZN 57 1_555 ? ? ? ? ? ? ? 2.304 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 45 B . ? GLY 45 A PRO 46 B ? PRO 46 A 1 0.02 2 GLY 45 B . ? GLY 45 A PRO 46 B ? PRO 46 A 2 -0.04 3 GLY 45 B . ? GLY 45 A PRO 46 B ? PRO 46 A 3 -0.06 4 GLY 45 B . ? GLY 45 A PRO 46 B ? PRO 46 A 4 -0.13 5 GLY 45 B . ? GLY 45 A PRO 46 B ? PRO 46 A 5 0.01 6 GLY 45 B . ? GLY 45 A PRO 46 B ? PRO 46 A 6 -0.02 7 GLY 45 B . ? GLY 45 A PRO 46 B ? PRO 46 A 7 0.00 8 GLY 45 B . ? GLY 45 A PRO 46 B ? PRO 46 A 8 -0.12 9 GLY 45 B . ? GLY 45 A PRO 46 B ? PRO 46 A 9 -0.04 10 GLY 45 B . ? GLY 45 A PRO 46 B ? PRO 46 A 10 -0.01 11 GLY 45 B . ? GLY 45 A PRO 46 B ? PRO 46 A 11 -0.02 12 GLY 45 B . ? GLY 45 A PRO 46 B ? PRO 46 A 12 0.03 13 GLY 45 B . ? GLY 45 A PRO 46 B ? PRO 46 A 13 0.03 14 GLY 45 B . ? GLY 45 A PRO 46 B ? PRO 46 A 14 0.08 15 GLY 45 B . ? GLY 45 A PRO 46 B ? PRO 46 A 15 0.06 16 GLY 45 B . ? GLY 45 A PRO 46 B ? PRO 46 A 16 -0.02 17 GLY 45 B . ? GLY 45 A PRO 46 B ? PRO 46 A 17 -0.06 18 GLY 45 B . ? GLY 45 A PRO 46 B ? PRO 46 A 18 -0.01 19 GLY 45 B . ? GLY 45 A PRO 46 B ? PRO 46 A 19 0.07 20 GLY 45 B . ? GLY 45 A PRO 46 B ? PRO 46 A 20 0.10 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 57 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 57' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS B 26 ? CYS A 26 . ? 1_555 ? 2 AC1 4 CYS B 29 ? CYS A 29 . ? 1_555 ? 3 AC1 4 HIS B 34 ? HIS A 34 . ? 1_555 ? 4 AC1 4 CYS B 39 ? CYS A 39 . ? 1_555 ? # _database_PDB_matrix.entry_id 1WWE _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1WWE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 U 1 517 517 U U B . n A 1 2 U 2 518 518 U U B . n A 1 3 U 3 519 519 U U B . n A 1 4 U 4 520 520 U U B . n A 1 5 G 5 521 521 G G B . n A 1 6 C 6 522 522 C C B . n A 1 7 U 7 523 523 U U B . n B 2 1 ALA 1 1 1 ALA ALA A . n B 2 2 THR 2 2 2 THR THR A . n B 2 3 VAL 3 3 3 VAL VAL A . n B 2 4 VAL 4 4 4 VAL VAL A . n B 2 5 SER 5 5 5 SER SER A . n B 2 6 GLY 6 6 6 GLY GLY A . n B 2 7 GLN 7 7 7 GLN GLN A . n B 2 8 LYS 8 8 8 LYS LYS A . n B 2 9 GLN 9 9 9 GLN GLN A . n B 2 10 ASP 10 10 10 ASP ASP A . n B 2 11 ARG 11 11 11 ARG ARG A . n B 2 12 GLN 12 12 12 GLN GLN A . n B 2 13 GLY 13 13 13 GLY GLY A . n B 2 14 GLY 14 14 14 GLY GLY A . n B 2 15 GLU 15 15 15 GLU GLU A . n B 2 16 ARG 16 16 16 ARG ARG A . n B 2 17 ARG 17 17 17 ARG ARG A . n B 2 18 ARG 18 18 18 ARG ARG A . n B 2 19 SER 19 19 19 SER SER A . n B 2 20 GLN 20 20 20 GLN GLN A . n B 2 21 LEU 21 21 21 LEU LEU A . n B 2 22 ASP 22 22 22 ASP ASP A . n B 2 23 ARG 23 23 23 ARG ARG A . n B 2 24 ASP 24 24 24 ASP ASP A . n B 2 25 GLN 25 25 25 GLN GLN A . n B 2 26 CYS 26 26 26 CYS CYS A . n B 2 27 ALA 27 27 27 ALA ALA A . n B 2 28 TYR 28 28 28 TYR TYR A . n B 2 29 CYS 29 29 29 CYS CYS A . n B 2 30 LYS 30 30 30 LYS LYS A . n B 2 31 GLU 31 31 31 GLU GLU A . n B 2 32 LYS 32 32 32 LYS LYS A . n B 2 33 GLY 33 33 33 GLY GLY A . n B 2 34 HIS 34 34 34 HIS HIS A . n B 2 35 TRP 35 35 35 TRP TRP A . n B 2 36 ALA 36 36 36 ALA ALA A . n B 2 37 LYS 37 37 37 LYS LYS A . n B 2 38 ASP 38 38 38 ASP ASP A . n B 2 39 CYS 39 39 39 CYS CYS A . n B 2 40 PRO 40 40 40 PRO PRO A . n B 2 41 LYS 41 41 41 LYS LYS A . n B 2 42 LYS 42 42 42 LYS LYS A . n B 2 43 PRO 43 43 43 PRO PRO A . n B 2 44 ARG 44 44 44 ARG ARG A . n B 2 45 GLY 45 45 45 GLY GLY A . n B 2 46 PRO 46 46 46 PRO PRO A . n B 2 47 ARG 47 47 47 ARG ARG A . n B 2 48 GLY 48 48 48 GLY GLY A . n B 2 49 PRO 49 49 49 PRO PRO A . n B 2 50 ARG 50 50 50 ARG ARG A . n B 2 51 PRO 51 51 51 PRO PRO A . n B 2 52 GLN 52 52 52 GLN GLN A . n B 2 53 THR 53 53 53 THR THR A . n B 2 54 SER 54 54 54 SER SER A . n B 2 55 LEU 55 55 55 LEU LEU A . n B 2 56 LEU 56 56 56 LEU LEU A . n # _pdbx_nonpoly_scheme.asym_id C _pdbx_nonpoly_scheme.entity_id 3 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 57 _pdbx_nonpoly_scheme.auth_seq_num 57 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? B CYS 26 ? A CYS 26 ? 1_555 ZN ? C ZN . ? A ZN 57 ? 1_555 SG ? B CYS 29 ? A CYS 29 ? 1_555 111.7 ? 2 SG ? B CYS 26 ? A CYS 26 ? 1_555 ZN ? C ZN . ? A ZN 57 ? 1_555 NE2 ? B HIS 34 ? A HIS 34 ? 1_555 108.7 ? 3 SG ? B CYS 29 ? A CYS 29 ? 1_555 ZN ? C ZN . ? A ZN 57 ? 1_555 NE2 ? B HIS 34 ? A HIS 34 ? 1_555 108.5 ? 4 SG ? B CYS 26 ? A CYS 26 ? 1_555 ZN ? C ZN . ? A ZN 57 ? 1_555 SG ? B CYS 39 ? A CYS 39 ? 1_555 112.4 ? 5 SG ? B CYS 29 ? A CYS 29 ? 1_555 ZN ? C ZN . ? A ZN 57 ? 1_555 SG ? B CYS 39 ? A CYS 39 ? 1_555 106.5 ? 6 NE2 ? B HIS 34 ? A HIS 34 ? 1_555 ZN ? C ZN . ? A ZN 57 ? 1_555 SG ? B CYS 39 ? A CYS 39 ? 1_555 109.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-03-22 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.value' 16 4 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 29 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 30 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 31 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 31 ? ? H A LYS 32 ? ? 1.56 2 14 "O2'" B U 519 ? ? HZ1 A LYS 37 ? ? 1.57 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 "O4'" B U 517 ? ? "C4'" B U 517 ? ? "C3'" B U 517 ? ? 91.48 104.00 -12.52 1.00 N 2 1 "O4'" B U 518 ? ? "C4'" B U 518 ? ? "C3'" B U 518 ? ? 90.45 104.00 -13.55 1.00 N 3 1 "O4'" B U 519 ? ? "C4'" B U 519 ? ? "C3'" B U 519 ? ? 97.09 104.00 -6.91 1.00 N 4 1 "C1'" B U 519 ? ? "O4'" B U 519 ? ? "C4'" B U 519 ? ? 117.09 109.90 7.19 0.80 N 5 1 "O4'" B U 520 ? ? "C4'" B U 520 ? ? "C3'" B U 520 ? ? 90.13 104.00 -13.87 1.00 N 6 1 "O4'" B G 521 ? ? "C4'" B G 521 ? ? "C3'" B G 521 ? ? 94.03 104.00 -9.97 1.00 N 7 1 "C1'" B G 521 ? ? "O4'" B G 521 ? ? "C4'" B G 521 ? ? 116.77 109.90 6.87 0.80 N 8 1 C6 B G 521 ? ? N1 B G 521 ? ? C2 B G 521 ? ? 118.57 125.10 -6.53 0.60 N 9 1 N1 B G 521 ? ? C2 B G 521 ? ? N3 B G 521 ? ? 129.04 123.90 5.14 0.60 N 10 1 C5 B G 521 ? ? C6 B G 521 ? ? N1 B G 521 ? ? 117.39 111.50 5.89 0.50 N 11 1 "O4'" B C 522 ? ? "C4'" B C 522 ? ? "C3'" B C 522 ? ? 90.94 104.00 -13.06 1.00 N 12 1 "O4'" B U 523 ? ? "C4'" B U 523 ? ? "C3'" B U 523 ? ? 92.44 104.00 -11.56 1.00 N 13 1 "C1'" B U 523 ? ? "O4'" B U 523 ? ? "C4'" B U 523 ? ? 115.58 109.90 5.68 0.80 N 14 2 "O4'" B U 517 ? ? "C4'" B U 517 ? ? "C3'" B U 517 ? ? 91.36 104.00 -12.64 1.00 N 15 2 "O4'" B U 518 ? ? "C4'" B U 518 ? ? "C3'" B U 518 ? ? 91.33 104.00 -12.67 1.00 N 16 2 "O4'" B U 519 ? ? "C4'" B U 519 ? ? "C3'" B U 519 ? ? 96.13 104.00 -7.87 1.00 N 17 2 "C1'" B U 519 ? ? "O4'" B U 519 ? ? "C4'" B U 519 ? ? 117.25 109.90 7.35 0.80 N 18 2 "O4'" B U 520 ? ? "C4'" B U 520 ? ? "C3'" B U 520 ? ? 91.00 104.00 -13.00 1.00 N 19 2 "O4'" B G 521 ? ? "C4'" B G 521 ? ? "C3'" B G 521 ? ? 91.19 104.00 -12.81 1.00 N 20 2 C6 B G 521 ? ? N1 B G 521 ? ? C2 B G 521 ? ? 118.53 125.10 -6.57 0.60 N 21 2 N1 B G 521 ? ? C2 B G 521 ? ? N3 B G 521 ? ? 129.07 123.90 5.17 0.60 N 22 2 C5 B G 521 ? ? C6 B G 521 ? ? N1 B G 521 ? ? 117.35 111.50 5.85 0.50 N 23 2 "O4'" B C 522 ? ? "C4'" B C 522 ? ? "C3'" B C 522 ? ? 91.87 104.00 -12.13 1.00 N 24 2 "C1'" B C 522 ? ? "O4'" B C 522 ? ? "C4'" B C 522 ? ? 114.71 109.90 4.81 0.80 N 25 2 "O4'" B U 523 ? ? "C4'" B U 523 ? ? "C3'" B U 523 ? ? 91.62 104.00 -12.38 1.00 N 26 3 "O4'" B U 517 ? ? "C4'" B U 517 ? ? "C3'" B U 517 ? ? 96.22 104.00 -7.78 1.00 N 27 3 "C1'" B U 517 ? ? "O4'" B U 517 ? ? "C4'" B U 517 ? ? 117.20 109.90 7.30 0.80 N 28 3 "O4'" B U 518 ? ? "C4'" B U 518 ? ? "C3'" B U 518 ? ? 90.95 104.00 -13.05 1.00 N 29 3 "O4'" B U 519 ? ? "C4'" B U 519 ? ? "C3'" B U 519 ? ? 95.80 104.00 -8.20 1.00 N 30 3 "C1'" B U 519 ? ? "O4'" B U 519 ? ? "C4'" B U 519 ? ? 117.16 109.90 7.26 0.80 N 31 3 "O4'" B G 521 ? ? "C4'" B G 521 ? ? "C3'" B G 521 ? ? 91.36 104.00 -12.64 1.00 N 32 3 "C1'" B G 521 ? ? "O4'" B G 521 ? ? "C4'" B G 521 ? ? 114.70 109.90 4.80 0.80 N 33 3 C6 B G 521 ? ? N1 B G 521 ? ? C2 B G 521 ? ? 118.49 125.10 -6.61 0.60 N 34 3 N1 B G 521 ? ? C2 B G 521 ? ? N3 B G 521 ? ? 129.17 123.90 5.27 0.60 N 35 3 C5 B G 521 ? ? C6 B G 521 ? ? N1 B G 521 ? ? 117.36 111.50 5.86 0.50 N 36 3 "O4'" B C 522 ? ? "C4'" B C 522 ? ? "C3'" B C 522 ? ? 91.40 104.00 -12.60 1.00 N 37 3 "O4'" B U 523 ? ? "C4'" B U 523 ? ? "C3'" B U 523 ? ? 94.84 104.00 -9.16 1.00 N 38 3 "C1'" B U 523 ? ? "O4'" B U 523 ? ? "C4'" B U 523 ? ? 117.09 109.90 7.19 0.80 N 39 4 "C1'" B U 517 ? ? "O4'" B U 517 ? ? "C4'" B U 517 ? ? 116.77 109.90 6.87 0.80 N 40 4 "O4'" B U 518 ? ? "C4'" B U 518 ? ? "C3'" B U 518 ? ? 90.65 104.00 -13.35 1.00 N 41 4 "O4'" B U 519 ? ? "C4'" B U 519 ? ? "C3'" B U 519 ? ? 97.63 104.00 -6.37 1.00 N 42 4 "C1'" B U 519 ? ? "O4'" B U 519 ? ? "C4'" B U 519 ? ? 116.97 109.90 7.07 0.80 N 43 4 "O4'" B U 520 ? ? "C4'" B U 520 ? ? "C3'" B U 520 ? ? 91.50 104.00 -12.50 1.00 N 44 4 "O4'" B G 521 ? ? "C4'" B G 521 ? ? "C3'" B G 521 ? ? 95.89 104.00 -8.11 1.00 N 45 4 "C1'" B G 521 ? ? "O4'" B G 521 ? ? "C4'" B G 521 ? ? 117.27 109.90 7.37 0.80 N 46 4 C6 B G 521 ? ? N1 B G 521 ? ? C2 B G 521 ? ? 118.50 125.10 -6.60 0.60 N 47 4 N1 B G 521 ? ? C2 B G 521 ? ? N3 B G 521 ? ? 129.09 123.90 5.19 0.60 N 48 4 C5 B G 521 ? ? C6 B G 521 ? ? N1 B G 521 ? ? 117.41 111.50 5.91 0.50 N 49 4 "O4'" B C 522 ? ? "C4'" B C 522 ? ? "C3'" B C 522 ? ? 91.30 104.00 -12.70 1.00 N 50 4 "O4'" B U 523 ? ? "C4'" B U 523 ? ? "C3'" B U 523 ? ? 91.52 104.00 -12.48 1.00 N 51 5 "O4'" B U 517 ? ? "C4'" B U 517 ? ? "C3'" B U 517 ? ? 90.84 104.00 -13.16 1.00 N 52 5 "O4'" B U 518 ? ? "C4'" B U 518 ? ? "C3'" B U 518 ? ? 90.88 104.00 -13.12 1.00 N 53 5 "O4'" B U 519 ? ? "C4'" B U 519 ? ? "C3'" B U 519 ? ? 97.44 104.00 -6.56 1.00 N 54 5 "C1'" B U 519 ? ? "O4'" B U 519 ? ? "C4'" B U 519 ? ? 117.00 109.90 7.10 0.80 N 55 5 "O4'" B U 520 ? ? "C4'" B U 520 ? ? "C3'" B U 520 ? ? 92.43 104.00 -11.57 1.00 N 56 5 "C1'" B U 520 ? ? "O4'" B U 520 ? ? "C4'" B U 520 ? ? 115.54 109.90 5.64 0.80 N 57 5 "O4'" B G 521 ? ? "C4'" B G 521 ? ? "C3'" B G 521 ? ? 90.10 104.00 -13.90 1.00 N 58 5 C6 B G 521 ? ? N1 B G 521 ? ? C2 B G 521 ? ? 118.46 125.10 -6.64 0.60 N 59 5 N1 B G 521 ? ? C2 B G 521 ? ? N3 B G 521 ? ? 129.14 123.90 5.24 0.60 N 60 5 C5 B G 521 ? ? C6 B G 521 ? ? N1 B G 521 ? ? 117.39 111.50 5.89 0.50 N 61 5 "O4'" B C 522 ? ? "C4'" B C 522 ? ? "C3'" B C 522 ? ? 91.85 104.00 -12.15 1.00 N 62 6 "O4'" B U 517 ? ? "C4'" B U 517 ? ? "C3'" B U 517 ? ? 91.43 104.00 -12.57 1.00 N 63 6 "O4'" B U 518 ? ? "C4'" B U 518 ? ? "C3'" B U 518 ? ? 90.01 104.00 -13.99 1.00 N 64 6 "O4'" B U 519 ? ? "C4'" B U 519 ? ? "C3'" B U 519 ? ? 92.08 104.00 -11.92 1.00 N 65 6 "C1'" B U 519 ? ? "O4'" B U 519 ? ? "C4'" B U 519 ? ? 115.08 109.90 5.18 0.80 N 66 6 "C1'" B U 520 ? ? "O4'" B U 520 ? ? "C4'" B U 520 ? ? 116.67 109.90 6.77 0.80 N 67 6 "O4'" B G 521 ? ? "C4'" B G 521 ? ? "C3'" B G 521 ? ? 97.47 104.00 -6.53 1.00 N 68 6 "C1'" B G 521 ? ? "O4'" B G 521 ? ? "C4'" B G 521 ? ? 117.00 109.90 7.10 0.80 N 69 6 C6 B G 521 ? ? N1 B G 521 ? ? C2 B G 521 ? ? 118.47 125.10 -6.63 0.60 N 70 6 N1 B G 521 ? ? C2 B G 521 ? ? N3 B G 521 ? ? 129.13 123.90 5.23 0.60 N 71 6 C5 B G 521 ? ? C6 B G 521 ? ? N1 B G 521 ? ? 117.40 111.50 5.90 0.50 N 72 6 "O4'" B C 522 ? ? "C4'" B C 522 ? ? "C3'" B C 522 ? ? 91.56 104.00 -12.44 1.00 N 73 6 "C1'" B C 522 ? ? "O4'" B C 522 ? ? "C4'" B C 522 ? ? 114.82 109.90 4.92 0.80 N 74 6 "O4'" B U 523 ? ? "C4'" B U 523 ? ? "C3'" B U 523 ? ? 92.43 104.00 -11.57 1.00 N 75 6 "C1'" B U 523 ? ? "O4'" B U 523 ? ? "C4'" B U 523 ? ? 115.88 109.90 5.98 0.80 N 76 7 "O4'" B U 517 ? ? "C4'" B U 517 ? ? "C3'" B U 517 ? ? 94.07 104.00 -9.93 1.00 N 77 7 "C1'" B U 517 ? ? "O4'" B U 517 ? ? "C4'" B U 517 ? ? 116.80 109.90 6.90 0.80 N 78 7 "O4'" B U 518 ? ? "C4'" B U 518 ? ? "C3'" B U 518 ? ? 91.44 104.00 -12.56 1.00 N 79 7 "O4'" B U 519 ? ? "C4'" B U 519 ? ? "C3'" B U 519 ? ? 95.42 104.00 -8.58 1.00 N 80 7 "C1'" B U 519 ? ? "O4'" B U 519 ? ? "C4'" B U 519 ? ? 116.87 109.90 6.97 0.80 N 81 7 "C1'" B U 520 ? ? "O4'" B U 520 ? ? "C4'" B U 520 ? ? 115.10 109.90 5.20 0.80 N 82 7 "O4'" B G 521 ? ? "C4'" B G 521 ? ? "C3'" B G 521 ? ? 91.13 104.00 -12.87 1.00 N 83 7 C6 B G 521 ? ? N1 B G 521 ? ? C2 B G 521 ? ? 118.49 125.10 -6.61 0.60 N 84 7 N1 B G 521 ? ? C2 B G 521 ? ? N3 B G 521 ? ? 129.10 123.90 5.20 0.60 N 85 7 C5 B G 521 ? ? C6 B G 521 ? ? N1 B G 521 ? ? 117.44 111.50 5.94 0.50 N 86 7 "O4'" B C 522 ? ? "C4'" B C 522 ? ? "C3'" B C 522 ? ? 94.22 104.00 -9.78 1.00 N 87 7 "C1'" B C 522 ? ? "O4'" B C 522 ? ? "C4'" B C 522 ? ? 116.90 109.90 7.00 0.80 N 88 7 "O4'" B U 523 ? ? "C4'" B U 523 ? ? "C3'" B U 523 ? ? 92.20 104.00 -11.80 1.00 N 89 7 "C1'" B U 523 ? ? "O4'" B U 523 ? ? "C4'" B U 523 ? ? 115.31 109.90 5.41 0.80 N 90 8 "O4'" B U 517 ? ? "C4'" B U 517 ? ? "C3'" B U 517 ? ? 95.99 104.00 -8.01 1.00 N 91 8 "C1'" B U 517 ? ? "O4'" B U 517 ? ? "C4'" B U 517 ? ? 117.32 109.90 7.42 0.80 N 92 8 "O4'" B U 518 ? ? "C4'" B U 518 ? ? "C3'" B U 518 ? ? 90.36 104.00 -13.64 1.00 N 93 8 "O4'" B U 519 ? ? "C4'" B U 519 ? ? "C3'" B U 519 ? ? 95.26 104.00 -8.74 1.00 N 94 8 "C1'" B U 519 ? ? "O4'" B U 519 ? ? "C4'" B U 519 ? ? 116.89 109.90 6.99 0.80 N 95 8 "C1'" B U 520 ? ? "O4'" B U 520 ? ? "C4'" B U 520 ? ? 116.23 109.90 6.33 0.80 N 96 8 "O4'" B G 521 ? ? "C4'" B G 521 ? ? "C3'" B G 521 ? ? 91.98 104.00 -12.02 1.00 N 97 8 "C1'" B G 521 ? ? "O4'" B G 521 ? ? "C4'" B G 521 ? ? 115.34 109.90 5.44 0.80 N 98 8 C6 B G 521 ? ? N1 B G 521 ? ? C2 B G 521 ? ? 118.54 125.10 -6.56 0.60 N 99 8 N1 B G 521 ? ? C2 B G 521 ? ? N3 B G 521 ? ? 129.14 123.90 5.24 0.60 N 100 8 C5 B G 521 ? ? C6 B G 521 ? ? N1 B G 521 ? ? 117.34 111.50 5.84 0.50 N 101 8 "O4'" B C 522 ? ? "C4'" B C 522 ? ? "C3'" B C 522 ? ? 95.34 104.00 -8.66 1.00 N 102 8 "C1'" B C 522 ? ? "O4'" B C 522 ? ? "C4'" B C 522 ? ? 117.20 109.90 7.30 0.80 N 103 8 "O4'" B U 523 ? ? "C4'" B U 523 ? ? "C3'" B U 523 ? ? 90.90 104.00 -13.10 1.00 N 104 9 "C1'" B U 517 ? ? "O4'" B U 517 ? ? "C4'" B U 517 ? ? 116.27 109.90 6.37 0.80 N 105 9 "O4'" B U 518 ? ? "C4'" B U 518 ? ? "C3'" B U 518 ? ? 90.12 104.00 -13.88 1.00 N 106 9 "C1'" B U 519 ? ? "O4'" B U 519 ? ? "C4'" B U 519 ? ? 116.68 109.90 6.78 0.80 N 107 9 "O4'" B U 520 ? ? "C4'" B U 520 ? ? "C3'" B U 520 ? ? 90.62 104.00 -13.38 1.00 N 108 9 "O4'" B G 521 ? ? "C4'" B G 521 ? ? "C3'" B G 521 ? ? 91.97 104.00 -12.03 1.00 N 109 9 "C1'" B G 521 ? ? "O4'" B G 521 ? ? "C4'" B G 521 ? ? 114.78 109.90 4.88 0.80 N 110 9 C6 B G 521 ? ? N1 B G 521 ? ? C2 B G 521 ? ? 118.48 125.10 -6.62 0.60 N 111 9 N1 B G 521 ? ? C2 B G 521 ? ? N3 B G 521 ? ? 129.10 123.90 5.20 0.60 N 112 9 C5 B G 521 ? ? C6 B G 521 ? ? N1 B G 521 ? ? 117.46 111.50 5.96 0.50 N 113 9 "O4'" B C 522 ? ? "C4'" B C 522 ? ? "C3'" B C 522 ? ? 92.71 104.00 -11.29 1.00 N 114 9 "C1'" B C 522 ? ? "O4'" B C 522 ? ? "C4'" B C 522 ? ? 116.07 109.90 6.17 0.80 N 115 9 "O4'" B U 523 ? ? "C4'" B U 523 ? ? "C3'" B U 523 ? ? 96.31 104.00 -7.69 1.00 N 116 9 "C1'" B U 523 ? ? "O4'" B U 523 ? ? "C4'" B U 523 ? ? 117.23 109.90 7.33 0.80 N 117 10 "O4'" B U 517 ? ? "C4'" B U 517 ? ? "C3'" B U 517 ? ? 97.21 104.00 -6.79 1.00 N 118 10 "C1'" B U 517 ? ? "O4'" B U 517 ? ? "C4'" B U 517 ? ? 117.08 109.90 7.18 0.80 N 119 10 "O4'" B U 518 ? ? "C4'" B U 518 ? ? "C3'" B U 518 ? ? 90.14 104.00 -13.86 1.00 N 120 10 "O4'" B U 519 ? ? "C4'" B U 519 ? ? "C3'" B U 519 ? ? 96.12 104.00 -7.88 1.00 N 121 10 "C1'" B U 519 ? ? "O4'" B U 519 ? ? "C4'" B U 519 ? ? 117.18 109.90 7.28 0.80 N 122 10 "O4'" B U 520 ? ? "C4'" B U 520 ? ? "C3'" B U 520 ? ? 90.74 104.00 -13.26 1.00 N 123 10 "O4'" B G 521 ? ? "C4'" B G 521 ? ? "C3'" B G 521 ? ? 90.06 104.00 -13.94 1.00 N 124 10 C6 B G 521 ? ? N1 B G 521 ? ? C2 B G 521 ? ? 118.53 125.10 -6.57 0.60 N 125 10 N1 B G 521 ? ? C2 B G 521 ? ? N3 B G 521 ? ? 129.08 123.90 5.18 0.60 N 126 10 C5 B G 521 ? ? C6 B G 521 ? ? N1 B G 521 ? ? 117.40 111.50 5.90 0.50 N 127 10 "C1'" B C 522 ? ? "O4'" B C 522 ? ? "C4'" B C 522 ? ? 115.59 109.90 5.69 0.80 N 128 10 "O4'" B U 523 ? ? "C4'" B U 523 ? ? "C3'" B U 523 ? ? 94.61 104.00 -9.39 1.00 N 129 10 "C1'" B U 523 ? ? "O4'" B U 523 ? ? "C4'" B U 523 ? ? 116.97 109.90 7.07 0.80 N 130 11 "O4'" B U 517 ? ? "C4'" B U 517 ? ? "C3'" B U 517 ? ? 91.60 104.00 -12.40 1.00 N 131 11 "O4'" B U 518 ? ? "C4'" B U 518 ? ? "C3'" B U 518 ? ? 90.94 104.00 -13.06 1.00 N 132 11 "O4'" B U 519 ? ? "C4'" B U 519 ? ? "C3'" B U 519 ? ? 96.34 104.00 -7.66 1.00 N 133 11 "C1'" B U 519 ? ? "O4'" B U 519 ? ? "C4'" B U 519 ? ? 117.07 109.90 7.17 0.80 N 134 11 "C1'" B U 520 ? ? "O4'" B U 520 ? ? "C4'" B U 520 ? ? 115.43 109.90 5.53 0.80 N 135 11 "O4'" B G 521 ? ? "C4'" B G 521 ? ? "C3'" B G 521 ? ? 91.72 104.00 -12.28 1.00 N 136 11 "C1'" B G 521 ? ? "O4'" B G 521 ? ? "C4'" B G 521 ? ? 115.07 109.90 5.17 0.80 N 137 11 C6 B G 521 ? ? N1 B G 521 ? ? C2 B G 521 ? ? 118.45 125.10 -6.65 0.60 N 138 11 N1 B G 521 ? ? C2 B G 521 ? ? N3 B G 521 ? ? 129.13 123.90 5.23 0.60 N 139 11 C5 B G 521 ? ? C6 B G 521 ? ? N1 B G 521 ? ? 117.41 111.50 5.91 0.50 N 140 11 "O4'" B C 522 ? ? "C4'" B C 522 ? ? "C3'" B C 522 ? ? 97.04 104.00 -6.96 1.00 N 141 11 "C1'" B C 522 ? ? "O4'" B C 522 ? ? "C4'" B C 522 ? ? 117.09 109.90 7.19 0.80 N 142 11 "O4'" B U 523 ? ? "C4'" B U 523 ? ? "C3'" B U 523 ? ? 94.24 104.00 -9.76 1.00 N 143 11 "C1'" B U 523 ? ? "O4'" B U 523 ? ? "C4'" B U 523 ? ? 116.82 109.90 6.92 0.80 N 144 12 "O4'" B U 517 ? ? "C4'" B U 517 ? ? "C3'" B U 517 ? ? 94.45 104.00 -9.55 1.00 N 145 12 "C1'" B U 517 ? ? "O4'" B U 517 ? ? "C4'" B U 517 ? ? 117.01 109.90 7.11 0.80 N 146 12 "O4'" B U 518 ? ? "C4'" B U 518 ? ? "C3'" B U 518 ? ? 90.40 104.00 -13.60 1.00 N 147 12 "O4'" B U 519 ? ? "C4'" B U 519 ? ? "C3'" B U 519 ? ? 97.65 104.00 -6.35 1.00 N 148 12 "C1'" B U 519 ? ? "O4'" B U 519 ? ? "C4'" B U 519 ? ? 117.02 109.90 7.12 0.80 N 149 12 "O4'" B U 520 ? ? "C4'" B U 520 ? ? "C3'" B U 520 ? ? 90.15 104.00 -13.85 1.00 N 150 12 "O4'" B G 521 ? ? "C4'" B G 521 ? ? "C3'" B G 521 ? ? 91.15 104.00 -12.85 1.00 N 151 12 C6 B G 521 ? ? N1 B G 521 ? ? C2 B G 521 ? ? 118.54 125.10 -6.56 0.60 N 152 12 N1 B G 521 ? ? C2 B G 521 ? ? N3 B G 521 ? ? 129.07 123.90 5.17 0.60 N 153 12 C5 B G 521 ? ? C6 B G 521 ? ? N1 B G 521 ? ? 117.40 111.50 5.90 0.50 N 154 12 "C1'" B C 522 ? ? "O4'" B C 522 ? ? "C4'" B C 522 ? ? 115.90 109.90 6.00 0.80 N 155 12 "O4'" B U 523 ? ? "C4'" B U 523 ? ? "C3'" B U 523 ? ? 91.89 104.00 -12.11 1.00 N 156 12 "C1'" B U 523 ? ? "O4'" B U 523 ? ? "C4'" B U 523 ? ? 114.81 109.90 4.91 0.80 N 157 13 "C1'" B U 517 ? ? "O4'" B U 517 ? ? "C4'" B U 517 ? ? 116.49 109.90 6.59 0.80 N 158 13 "O4'" B U 518 ? ? "C4'" B U 518 ? ? "C3'" B U 518 ? ? 91.29 104.00 -12.71 1.00 N 159 13 "O4'" B U 519 ? ? "C4'" B U 519 ? ? "C3'" B U 519 ? ? 95.30 104.00 -8.70 1.00 N 160 13 "C1'" B U 519 ? ? "O4'" B U 519 ? ? "C4'" B U 519 ? ? 116.83 109.90 6.93 0.80 N 161 13 "O4'" B U 520 ? ? "C4'" B U 520 ? ? "C3'" B U 520 ? ? 92.22 104.00 -11.78 1.00 N 162 13 "C1'" B U 520 ? ? "O4'" B U 520 ? ? "C4'" B U 520 ? ? 115.22 109.90 5.32 0.80 N 163 13 "O4'" B G 521 ? ? "C4'" B G 521 ? ? "C3'" B G 521 ? ? 91.33 104.00 -12.67 1.00 N 164 13 C6 B G 521 ? ? N1 B G 521 ? ? C2 B G 521 ? ? 118.48 125.10 -6.62 0.60 N 165 13 N1 B G 521 ? ? C2 B G 521 ? ? N3 B G 521 ? ? 129.09 123.90 5.19 0.60 N 166 13 C5 B G 521 ? ? C6 B G 521 ? ? N1 B G 521 ? ? 117.42 111.50 5.92 0.50 N 167 13 "O4'" B C 522 ? ? "C4'" B C 522 ? ? "C3'" B C 522 ? ? 91.55 104.00 -12.45 1.00 N 168 13 "C1'" B C 522 ? ? "O4'" B C 522 ? ? "C4'" B C 522 ? ? 114.91 109.90 5.01 0.80 N 169 13 "O4'" B U 523 ? ? "C4'" B U 523 ? ? "C3'" B U 523 ? ? 91.50 104.00 -12.50 1.00 N 170 14 "O4'" B U 517 ? ? "C4'" B U 517 ? ? "C3'" B U 517 ? ? 91.26 104.00 -12.74 1.00 N 171 14 "O4'" B U 518 ? ? "C4'" B U 518 ? ? "C3'" B U 518 ? ? 90.59 104.00 -13.41 1.00 N 172 14 "O4'" B U 519 ? ? "C4'" B U 519 ? ? "C3'" B U 519 ? ? 94.92 104.00 -9.08 1.00 N 173 14 "C1'" B U 519 ? ? "O4'" B U 519 ? ? "C4'" B U 519 ? ? 116.85 109.90 6.95 0.80 N 174 14 "O4'" B U 520 ? ? "C4'" B U 520 ? ? "C3'" B U 520 ? ? 91.68 104.00 -12.32 1.00 N 175 14 "C1'" B G 521 ? ? "O4'" B G 521 ? ? "C4'" B G 521 ? ? 115.29 109.90 5.39 0.80 N 176 14 C6 B G 521 ? ? N1 B G 521 ? ? C2 B G 521 ? ? 118.48 125.10 -6.62 0.60 N 177 14 N1 B G 521 ? ? C2 B G 521 ? ? N3 B G 521 ? ? 129.14 123.90 5.24 0.60 N 178 14 C5 B G 521 ? ? C6 B G 521 ? ? N1 B G 521 ? ? 117.39 111.50 5.89 0.50 N 179 14 "O4'" B C 522 ? ? "C4'" B C 522 ? ? "C3'" B C 522 ? ? 94.12 104.00 -9.88 1.00 N 180 14 "C1'" B C 522 ? ? "O4'" B C 522 ? ? "C4'" B C 522 ? ? 116.90 109.90 7.00 0.80 N 181 14 "O4'" B U 523 ? ? "C4'" B U 523 ? ? "C3'" B U 523 ? ? 91.90 104.00 -12.10 1.00 N 182 14 "C1'" B U 523 ? ? "O4'" B U 523 ? ? "C4'" B U 523 ? ? 115.02 109.90 5.12 0.80 N 183 15 "O4'" B U 518 ? ? "C4'" B U 518 ? ? "C3'" B U 518 ? ? 93.53 104.00 -10.47 1.00 N 184 15 "C1'" B U 518 ? ? "O4'" B U 518 ? ? "C4'" B U 518 ? ? 116.46 109.90 6.56 0.80 N 185 15 "O4'" B U 519 ? ? "C4'" B U 519 ? ? "C3'" B U 519 ? ? 95.50 104.00 -8.50 1.00 N 186 15 "C1'" B U 519 ? ? "O4'" B U 519 ? ? "C4'" B U 519 ? ? 116.99 109.90 7.09 0.80 N 187 15 "O4'" B U 520 ? ? "C4'" B U 520 ? ? "C3'" B U 520 ? ? 90.16 104.00 -13.84 1.00 N 188 15 "C1'" B G 521 ? ? "O4'" B G 521 ? ? "C4'" B G 521 ? ? 115.52 109.90 5.62 0.80 N 189 15 C6 B G 521 ? ? N1 B G 521 ? ? C2 B G 521 ? ? 118.51 125.10 -6.59 0.60 N 190 15 N1 B G 521 ? ? C2 B G 521 ? ? N3 B G 521 ? ? 129.08 123.90 5.18 0.60 N 191 15 C5 B G 521 ? ? C6 B G 521 ? ? N1 B G 521 ? ? 117.36 111.50 5.86 0.50 N 192 15 "O4'" B C 522 ? ? "C4'" B C 522 ? ? "C3'" B C 522 ? ? 91.77 104.00 -12.23 1.00 N 193 15 "O4'" B U 523 ? ? "C4'" B U 523 ? ? "C3'" B U 523 ? ? 91.25 104.00 -12.75 1.00 N 194 16 "O4'" B U 517 ? ? "C4'" B U 517 ? ? "C3'" B U 517 ? ? 94.55 104.00 -9.45 1.00 N 195 16 "C1'" B U 517 ? ? "O4'" B U 517 ? ? "C4'" B U 517 ? ? 117.00 109.90 7.10 0.80 N 196 16 "O4'" B U 518 ? ? "C4'" B U 518 ? ? "C3'" B U 518 ? ? 91.51 104.00 -12.49 1.00 N 197 16 "C1'" B U 518 ? ? "O4'" B U 518 ? ? "C4'" B U 518 ? ? 114.82 109.90 4.92 0.80 N 198 16 "O4'" B U 519 ? ? "C4'" B U 519 ? ? "C3'" B U 519 ? ? 95.51 104.00 -8.49 1.00 N 199 16 "C1'" B U 519 ? ? "O4'" B U 519 ? ? "C4'" B U 519 ? ? 116.89 109.90 6.99 0.80 N 200 16 "O4'" B U 520 ? ? "C4'" B U 520 ? ? "C3'" B U 520 ? ? 90.17 104.00 -13.83 1.00 N 201 16 "O4'" B G 521 ? ? "C4'" B G 521 ? ? "C3'" B G 521 ? ? 96.35 104.00 -7.65 1.00 N 202 16 "C1'" B G 521 ? ? "O4'" B G 521 ? ? "C4'" B G 521 ? ? 116.98 109.90 7.08 0.80 N 203 16 C6 B G 521 ? ? N1 B G 521 ? ? C2 B G 521 ? ? 118.49 125.10 -6.61 0.60 N 204 16 N1 B G 521 ? ? C2 B G 521 ? ? N3 B G 521 ? ? 129.05 123.90 5.15 0.60 N 205 16 C5 B G 521 ? ? C6 B G 521 ? ? N1 B G 521 ? ? 117.42 111.50 5.92 0.50 N 206 16 "O4'" B C 522 ? ? "C4'" B C 522 ? ? "C3'" B C 522 ? ? 91.22 104.00 -12.78 1.00 N 207 16 "O4'" B U 523 ? ? "C4'" B U 523 ? ? "C3'" B U 523 ? ? 94.20 104.00 -9.80 1.00 N 208 16 "C1'" B U 523 ? ? "O4'" B U 523 ? ? "C4'" B U 523 ? ? 116.79 109.90 6.89 0.80 N 209 17 "C1'" B U 517 ? ? "O4'" B U 517 ? ? "C4'" B U 517 ? ? 116.47 109.90 6.57 0.80 N 210 17 "O4'" B U 518 ? ? "C4'" B U 518 ? ? "C3'" B U 518 ? ? 90.10 104.00 -13.90 1.00 N 211 17 "O4'" B U 519 ? ? "C4'" B U 519 ? ? "C3'" B U 519 ? ? 95.49 104.00 -8.51 1.00 N 212 17 "C1'" B U 519 ? ? "O4'" B U 519 ? ? "C4'" B U 519 ? ? 116.89 109.90 6.99 0.80 N 213 17 "O4'" B U 520 ? ? "C4'" B U 520 ? ? "C3'" B U 520 ? ? 91.32 104.00 -12.68 1.00 N 214 17 "O4'" B G 521 ? ? "C4'" B G 521 ? ? "C3'" B G 521 ? ? 91.25 104.00 -12.75 1.00 N 215 17 C6 B G 521 ? ? N1 B G 521 ? ? C2 B G 521 ? ? 118.56 125.10 -6.54 0.60 N 216 17 N1 B G 521 ? ? C2 B G 521 ? ? N3 B G 521 ? ? 129.05 123.90 5.15 0.60 N 217 17 C5 B G 521 ? ? C6 B G 521 ? ? N1 B G 521 ? ? 117.39 111.50 5.89 0.50 N 218 17 "O4'" B C 522 ? ? "C4'" B C 522 ? ? "C3'" B C 522 ? ? 91.74 104.00 -12.26 1.00 N 219 17 "O4'" B U 523 ? ? "C4'" B U 523 ? ? "C3'" B U 523 ? ? 91.69 104.00 -12.31 1.00 N 220 17 "C1'" B U 523 ? ? "O4'" B U 523 ? ? "C4'" B U 523 ? ? 114.81 109.90 4.91 0.80 N 221 18 "O4'" B U 517 ? ? "C4'" B U 517 ? ? "C3'" B U 517 ? ? 91.85 104.00 -12.15 1.00 N 222 18 "C1'" B U 517 ? ? "O4'" B U 517 ? ? "C4'" B U 517 ? ? 114.77 109.90 4.87 0.80 N 223 18 "O4'" B U 518 ? ? "C4'" B U 518 ? ? "C3'" B U 518 ? ? 92.52 104.00 -11.48 1.00 N 224 18 "C1'" B U 518 ? ? "O4'" B U 518 ? ? "C4'" B U 518 ? ? 115.56 109.90 5.66 0.80 N 225 18 "O4'" B U 519 ? ? "C4'" B U 519 ? ? "C3'" B U 519 ? ? 97.06 104.00 -6.94 1.00 N 226 18 "C1'" B U 519 ? ? "O4'" B U 519 ? ? "C4'" B U 519 ? ? 117.14 109.90 7.24 0.80 N 227 18 "O4'" B U 520 ? ? "C4'" B U 520 ? ? "C3'" B U 520 ? ? 96.19 104.00 -7.81 1.00 N 228 18 "C1'" B U 520 ? ? "O4'" B U 520 ? ? "C4'" B U 520 ? ? 116.81 109.90 6.91 0.80 N 229 18 "O4'" B G 521 ? ? "C4'" B G 521 ? ? "C3'" B G 521 ? ? 91.35 104.00 -12.65 1.00 N 230 18 C6 B G 521 ? ? N1 B G 521 ? ? C2 B G 521 ? ? 118.53 125.10 -6.57 0.60 N 231 18 N1 B G 521 ? ? C2 B G 521 ? ? N3 B G 521 ? ? 129.11 123.90 5.21 0.60 N 232 18 C5 B G 521 ? ? C6 B G 521 ? ? N1 B G 521 ? ? 117.38 111.50 5.88 0.50 N 233 18 "C1'" B C 522 ? ? "O4'" B C 522 ? ? "C4'" B C 522 ? ? 116.12 109.90 6.22 0.80 N 234 18 "O4'" B U 523 ? ? "C4'" B U 523 ? ? "C3'" B U 523 ? ? 91.47 104.00 -12.53 1.00 N 235 19 "O4'" B U 517 ? ? "C4'" B U 517 ? ? "C3'" B U 517 ? ? 90.87 104.00 -13.13 1.00 N 236 19 "O4'" B U 518 ? ? "C4'" B U 518 ? ? "C3'" B U 518 ? ? 90.17 104.00 -13.83 1.00 N 237 19 "O4'" B U 519 ? ? "C4'" B U 519 ? ? "C3'" B U 519 ? ? 95.42 104.00 -8.58 1.00 N 238 19 "C1'" B U 519 ? ? "O4'" B U 519 ? ? "C4'" B U 519 ? ? 116.88 109.90 6.98 0.80 N 239 19 "O4'" B G 521 ? ? "C4'" B G 521 ? ? "C3'" B G 521 ? ? 94.91 104.00 -9.09 1.00 N 240 19 "C1'" B G 521 ? ? "O4'" B G 521 ? ? "C4'" B G 521 ? ? 116.89 109.90 6.99 0.80 N 241 19 C6 B G 521 ? ? N1 B G 521 ? ? C2 B G 521 ? ? 118.47 125.10 -6.63 0.60 N 242 19 N1 B G 521 ? ? C2 B G 521 ? ? N3 B G 521 ? ? 129.09 123.90 5.19 0.60 N 243 19 C5 B G 521 ? ? C6 B G 521 ? ? N1 B G 521 ? ? 117.43 111.50 5.93 0.50 N 244 19 "O4'" B C 522 ? ? "C4'" B C 522 ? ? "C3'" B C 522 ? ? 93.78 104.00 -10.22 1.00 N 245 19 "C1'" B C 522 ? ? "O4'" B C 522 ? ? "C4'" B C 522 ? ? 116.63 109.90 6.73 0.80 N 246 19 "O4'" B U 523 ? ? "C4'" B U 523 ? ? "C3'" B U 523 ? ? 93.83 104.00 -10.17 1.00 N 247 19 "C1'" B U 523 ? ? "O4'" B U 523 ? ? "C4'" B U 523 ? ? 116.65 109.90 6.75 0.80 N 248 20 "C1'" B U 517 ? ? "O4'" B U 517 ? ? "C4'" B U 517 ? ? 116.55 109.90 6.65 0.80 N 249 20 "O4'" B U 518 ? ? "C4'" B U 518 ? ? "C3'" B U 518 ? ? 90.28 104.00 -13.72 1.00 N 250 20 "O4'" B U 519 ? ? "C4'" B U 519 ? ? "C3'" B U 519 ? ? 96.83 104.00 -7.17 1.00 N 251 20 "C1'" B U 519 ? ? "O4'" B U 519 ? ? "C4'" B U 519 ? ? 117.23 109.90 7.33 0.80 N 252 20 "O4'" B U 520 ? ? "C4'" B U 520 ? ? "C3'" B U 520 ? ? 90.14 104.00 -13.86 1.00 N 253 20 "O4'" B G 521 ? ? "C4'" B G 521 ? ? "C3'" B G 521 ? ? 91.16 104.00 -12.84 1.00 N 254 20 C6 B G 521 ? ? N1 B G 521 ? ? C2 B G 521 ? ? 118.50 125.10 -6.60 0.60 N 255 20 N1 B G 521 ? ? C2 B G 521 ? ? N3 B G 521 ? ? 129.10 123.90 5.20 0.60 N 256 20 C5 B G 521 ? ? C6 B G 521 ? ? N1 B G 521 ? ? 117.41 111.50 5.91 0.50 N 257 20 "O4'" B C 522 ? ? "C4'" B C 522 ? ? "C3'" B C 522 ? ? 91.05 104.00 -12.95 1.00 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 9 ? ? -125.53 -59.21 2 1 ARG A 11 ? ? -43.08 160.08 3 1 GLU A 15 ? ? -167.66 99.93 4 1 ARG A 16 ? ? -173.96 85.13 5 1 ARG A 17 ? ? 63.94 130.84 6 1 SER A 19 ? ? 64.14 -77.48 7 1 GLN A 20 ? ? -168.63 31.45 8 1 LEU A 21 ? ? -40.98 105.05 9 1 TYR A 28 ? ? -132.05 -52.79 10 1 LYS A 30 ? ? 91.61 24.48 11 1 ARG A 50 ? ? -166.17 96.71 12 1 GLN A 52 ? ? 45.18 88.86 13 2 ARG A 11 ? ? -151.24 -55.50 14 2 GLU A 15 ? ? -142.40 -58.52 15 2 SER A 19 ? ? 62.81 -79.48 16 2 GLN A 20 ? ? -160.80 34.42 17 2 TYR A 28 ? ? -136.76 -51.12 18 2 LYS A 30 ? ? 91.12 26.08 19 2 LYS A 42 ? ? -50.11 106.43 20 2 GLN A 52 ? ? -175.96 -53.00 21 2 THR A 53 ? ? 33.57 48.78 22 2 SER A 54 ? ? 58.51 160.31 23 2 LEU A 55 ? ? 65.87 111.00 24 3 GLN A 9 ? ? -177.19 91.53 25 3 GLN A 12 ? ? 53.53 93.45 26 3 ARG A 16 ? ? -174.20 100.60 27 3 ARG A 18 ? ? 39.81 29.44 28 3 TYR A 28 ? ? -132.44 -50.51 29 3 LYS A 30 ? ? 90.81 26.97 30 4 GLN A 9 ? ? -165.45 110.15 31 4 GLU A 15 ? ? -102.26 -61.94 32 4 ARG A 16 ? ? 67.77 114.94 33 4 ARG A 17 ? ? 177.88 129.05 34 4 SER A 19 ? ? -40.47 97.84 35 4 GLN A 20 ? ? 38.85 53.91 36 4 TYR A 28 ? ? -133.06 -50.29 37 4 LYS A 30 ? ? 91.23 25.36 38 4 ARG A 44 ? ? -100.27 75.81 39 4 ARG A 50 ? ? -51.19 106.85 40 4 GLN A 52 ? ? 43.46 76.70 41 4 LEU A 55 ? ? 179.07 178.87 42 5 THR A 2 ? ? 46.66 -172.44 43 5 SER A 5 ? ? -178.05 121.20 44 5 ARG A 18 ? ? -175.90 50.63 45 5 GLN A 20 ? ? 38.90 52.70 46 5 TYR A 28 ? ? -133.83 -52.66 47 5 LYS A 30 ? ? 88.45 22.93 48 5 LYS A 42 ? ? -50.71 106.79 49 6 ARG A 16 ? ? -167.24 -59.36 50 6 ARG A 17 ? ? 177.46 122.03 51 6 ARG A 18 ? ? -109.75 45.11 52 6 SER A 19 ? ? 55.31 -93.02 53 6 TYR A 28 ? ? -131.47 -60.32 54 6 LYS A 30 ? ? 96.14 29.04 55 6 LEU A 55 ? ? 64.05 132.17 56 7 VAL A 3 ? ? -171.59 122.73 57 7 GLU A 15 ? ? -89.04 43.40 58 7 ARG A 17 ? ? -111.22 64.85 59 7 SER A 19 ? ? -44.49 95.66 60 7 GLN A 20 ? ? 38.62 42.69 61 7 TYR A 28 ? ? -131.03 -51.10 62 7 LYS A 30 ? ? 89.58 27.56 63 7 LYS A 42 ? ? -51.39 107.06 64 7 GLN A 52 ? ? -171.44 129.97 65 7 THR A 53 ? ? 60.54 145.55 66 7 SER A 54 ? ? -152.98 -57.93 67 8 THR A 2 ? ? -166.40 109.71 68 8 SER A 5 ? ? 167.82 143.25 69 8 GLN A 7 ? ? -172.33 147.12 70 8 SER A 19 ? ? -39.27 97.44 71 8 GLN A 20 ? ? 38.79 56.66 72 8 ALA A 27 ? ? -96.54 34.59 73 8 TYR A 28 ? ? -128.16 -54.78 74 8 LYS A 30 ? ? 92.53 25.40 75 8 LYS A 42 ? ? -52.88 107.89 76 8 THR A 53 ? ? 59.99 117.18 77 8 LEU A 55 ? ? 80.68 -74.25 78 9 SER A 5 ? ? 65.73 127.24 79 9 GLN A 7 ? ? -103.67 73.09 80 9 ARG A 11 ? ? -178.69 138.20 81 9 GLU A 15 ? ? 64.63 149.81 82 9 ARG A 16 ? ? 178.63 157.86 83 9 SER A 19 ? ? 39.25 -150.45 84 9 GLN A 20 ? ? -88.18 42.14 85 9 TYR A 28 ? ? -130.49 -51.46 86 9 LYS A 30 ? ? 91.18 26.08 87 9 ARG A 47 ? ? 62.45 95.16 88 9 GLN A 52 ? ? 63.20 159.72 89 9 SER A 54 ? ? -173.60 -57.11 90 9 LEU A 55 ? ? 60.60 109.55 91 10 SER A 5 ? ? 179.53 120.72 92 10 LYS A 8 ? ? -159.25 65.83 93 10 ASP A 10 ? ? -178.18 102.07 94 10 GLN A 12 ? ? 44.40 75.24 95 10 ARG A 16 ? ? 48.18 86.34 96 10 ARG A 17 ? ? -167.43 103.76 97 10 SER A 19 ? ? -39.71 97.07 98 10 GLN A 20 ? ? 38.35 55.85 99 10 TYR A 28 ? ? -133.73 -55.00 100 10 LYS A 30 ? ? 96.65 28.11 101 10 ARG A 44 ? ? 65.73 142.25 102 10 ARG A 50 ? ? 41.27 89.41 103 10 GLN A 52 ? ? 54.56 170.63 104 10 LEU A 55 ? ? 64.21 92.80 105 11 VAL A 4 ? ? -173.99 147.51 106 11 SER A 19 ? ? -43.96 95.64 107 11 GLN A 20 ? ? 38.52 48.00 108 11 ALA A 27 ? ? -99.88 35.62 109 11 TYR A 28 ? ? -129.86 -52.07 110 11 LYS A 30 ? ? 90.96 27.36 111 11 ARG A 47 ? ? 175.59 155.23 112 11 GLN A 52 ? ? 60.19 92.66 113 11 LEU A 55 ? ? 67.19 105.91 114 12 THR A 2 ? ? -133.27 -53.95 115 12 VAL A 3 ? ? 62.45 133.47 116 12 GLN A 7 ? ? -171.40 111.20 117 12 ASP A 10 ? ? -170.81 96.80 118 12 ARG A 16 ? ? 63.42 84.56 119 12 ARG A 17 ? ? -179.82 -50.44 120 12 GLN A 20 ? ? -107.09 45.00 121 12 TYR A 28 ? ? -136.35 -52.13 122 12 LYS A 30 ? ? 90.90 24.84 123 12 ARG A 47 ? ? -39.38 141.68 124 12 ARG A 50 ? ? -152.16 65.82 125 12 SER A 54 ? ? -169.71 78.36 126 12 LEU A 55 ? ? -170.89 76.85 127 13 VAL A 3 ? ? -172.49 122.31 128 13 LYS A 8 ? ? -131.74 -64.00 129 13 GLN A 9 ? ? 63.40 80.99 130 13 GLN A 12 ? ? 60.67 160.04 131 13 ARG A 17 ? ? -171.40 -68.45 132 13 ARG A 18 ? ? -136.72 -45.39 133 13 GLN A 20 ? ? 82.97 -1.08 134 13 LEU A 21 ? ? -68.12 85.81 135 13 TYR A 28 ? ? -134.24 -53.61 136 13 LYS A 30 ? ? 90.27 23.95 137 13 ARG A 50 ? ? -169.67 94.51 138 14 LYS A 8 ? ? 60.26 82.03 139 14 ARG A 11 ? ? -177.68 86.48 140 14 GLN A 12 ? ? 64.09 144.17 141 14 ARG A 17 ? ? -38.90 133.27 142 14 ARG A 18 ? ? 179.81 58.70 143 14 SER A 19 ? ? 38.99 -150.31 144 14 GLN A 20 ? ? -91.77 36.49 145 14 TYR A 28 ? ? -131.02 -59.31 146 14 LYS A 30 ? ? 96.24 28.37 147 14 ARG A 44 ? ? -117.75 55.16 148 14 GLN A 52 ? ? 64.47 158.69 149 14 LEU A 55 ? ? -139.22 -64.39 150 15 LYS A 8 ? ? -162.98 89.39 151 15 ARG A 11 ? ? -168.02 84.78 152 15 GLU A 15 ? ? -172.53 148.23 153 15 ARG A 16 ? ? -174.75 -61.70 154 15 ARG A 17 ? ? -171.09 129.82 155 15 ARG A 18 ? ? -150.43 20.38 156 15 ALA A 27 ? ? -99.54 36.25 157 15 TYR A 28 ? ? -130.82 -52.24 158 15 LYS A 30 ? ? 91.56 26.58 159 15 LYS A 42 ? ? -50.73 106.77 160 15 GLN A 52 ? ? 65.03 85.46 161 16 VAL A 4 ? ? -171.27 146.04 162 16 SER A 5 ? ? 178.70 148.62 163 16 ASP A 10 ? ? -177.47 119.51 164 16 ARG A 16 ? ? 179.79 163.50 165 16 ARG A 17 ? ? 61.31 154.66 166 16 ARG A 18 ? ? -155.08 55.93 167 16 SER A 19 ? ? 39.30 -150.49 168 16 GLN A 20 ? ? -90.70 32.76 169 16 LEU A 21 ? ? -48.43 97.16 170 16 TYR A 28 ? ? -133.45 -55.05 171 16 LYS A 42 ? ? -57.69 109.91 172 16 ARG A 50 ? ? -168.00 68.97 173 16 GLN A 52 ? ? -125.28 -66.06 174 17 GLN A 9 ? ? -132.66 -60.23 175 17 ARG A 11 ? ? 178.64 157.72 176 17 ARG A 16 ? ? 178.50 157.26 177 17 GLN A 20 ? ? 39.04 50.49 178 17 LEU A 21 ? ? -52.90 103.50 179 17 TYR A 28 ? ? -133.24 -56.68 180 17 LYS A 30 ? ? 98.37 29.57 181 17 ARG A 50 ? ? 63.04 84.57 182 17 GLN A 52 ? ? 176.09 -35.88 183 17 THR A 53 ? ? 64.55 -75.52 184 17 LEU A 55 ? ? -104.58 67.75 185 18 THR A 2 ? ? 42.04 78.93 186 18 VAL A 3 ? ? -165.60 117.96 187 18 SER A 5 ? ? -153.99 79.45 188 18 GLN A 12 ? ? 55.57 90.82 189 18 ARG A 17 ? ? -120.65 -54.57 190 18 SER A 19 ? ? 36.99 -149.79 191 18 GLN A 20 ? ? -93.08 43.82 192 18 LEU A 21 ? ? -39.26 111.30 193 18 TYR A 28 ? ? -133.06 -52.17 194 18 LYS A 30 ? ? 86.66 23.05 195 18 LYS A 42 ? ? -50.06 106.41 196 18 ARG A 47 ? ? 63.04 162.84 197 18 ARG A 50 ? ? -39.01 99.51 198 18 GLN A 52 ? ? -174.11 123.90 199 18 THR A 53 ? ? 63.46 145.18 200 18 SER A 54 ? ? 65.37 81.01 201 18 LEU A 55 ? ? -174.34 62.37 202 19 SER A 5 ? ? -174.71 134.41 203 19 ASP A 10 ? ? 61.93 148.14 204 19 ARG A 11 ? ? 51.29 85.59 205 19 GLN A 12 ? ? -176.29 79.83 206 19 GLU A 15 ? ? 60.70 123.03 207 19 ARG A 16 ? ? 67.67 123.01 208 19 ARG A 17 ? ? 178.98 109.35 209 19 ALA A 27 ? ? -98.28 35.43 210 19 TYR A 28 ? ? -129.82 -54.94 211 19 LYS A 30 ? ? 83.63 24.18 212 19 ARG A 44 ? ? 56.61 109.17 213 19 ARG A 47 ? ? 39.17 78.93 214 19 PRO A 51 ? ? -75.00 -169.50 215 19 GLN A 52 ? ? 38.71 41.26 216 19 SER A 54 ? ? 54.93 172.12 217 19 LEU A 55 ? ? 69.71 -65.93 218 20 GLN A 7 ? ? -173.14 115.16 219 20 LYS A 8 ? ? -174.28 91.53 220 20 GLU A 15 ? ? 68.58 157.47 221 20 ARG A 16 ? ? 54.60 82.46 222 20 SER A 19 ? ? 65.18 -75.20 223 20 GLN A 20 ? ? -164.91 30.74 224 20 TYR A 28 ? ? -134.75 -56.93 225 20 LYS A 30 ? ? 92.80 29.38 226 20 LYS A 42 ? ? -48.28 105.41 227 20 ARG A 44 ? ? -66.83 94.63 228 20 ARG A 47 ? ? 67.91 158.56 229 20 ARG A 50 ? ? -38.44 99.12 230 20 SER A 54 ? ? 61.01 162.00 231 20 LEU A 55 ? ? 54.31 99.62 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #