data_1X04 # _entry.id 1X04 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.284 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1X04 RCSB RCSB024211 WWPDB D_1000024211 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1X03 _pdbx_database_related.details 'endophilin BAR domain' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1X04 _pdbx_database_status.recvd_initial_deposition_date 2005-03-14 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Masuda, M.' 1 'Takeda, S.' 2 'Sone, M.' 3 'Kamioka, Y.' 4 'Mori, H.' 5 'Mochizuki, N.' 6 # _citation.id primary _citation.title 'Endophilin BAR domain drives membrane curvature by two newly identified structure-based mechanisms' _citation.journal_abbrev 'Embo J.' _citation.journal_volume 25 _citation.page_first 2889 _citation.page_last 2897 _citation.year 2006 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16763557 _citation.pdbx_database_id_DOI 10.1038/sj.emboj.7601176 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Masuda, M.' 1 primary 'Takeda, S.' 2 primary 'Sone, M.' 3 primary 'Ohki, T.' 4 primary 'Mori, H.' 5 primary 'Kamioka, Y.' 6 primary 'Mochizuki, N.' 7 # _cell.entry_id 1X04 _cell.length_a 129.077 _cell.length_b 129.077 _cell.length_c 97.963 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1X04 _symmetry.space_group_name_H-M 'I 41' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 80 _symmetry.space_group_name_Hall ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SH3-containing GRB2-like protein 2' _entity.formula_weight 26610.146 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.3.1.- _entity.pdbx_mutation ? _entity.pdbx_fragment 'endophilin A1 BAR domain (residues 59-66)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'endophilin A1, SH3 domain protein 2A, Endophilin 1, EEN-B1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GPLGS(MSE)SVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKE(MSE)ERKVDVTSRAV(MSE)EI(MSE)TKTIEYLA HLSSLLQAEALLAEA(MSE)LKFGRELGDDCNFGPALGEVGEA(MSE)RELSEVKDSLDIEVKQNFIDPLQNLHDKDLRE IQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESS(MSE)FNLLE(MSE)DIEQVSQLSALVQAQLEY HKQAVQILQQVTVRLEERIRQA ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSMSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLAHLSSLLQAEALLAEAM LKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGK IPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 MSE n 1 7 SER n 1 8 VAL n 1 9 ALA n 1 10 GLY n 1 11 LEU n 1 12 LYS n 1 13 LYS n 1 14 GLN n 1 15 PHE n 1 16 HIS n 1 17 LYS n 1 18 ALA n 1 19 THR n 1 20 GLN n 1 21 LYS n 1 22 VAL n 1 23 SER n 1 24 GLU n 1 25 LYS n 1 26 VAL n 1 27 GLY n 1 28 GLY n 1 29 ALA n 1 30 GLU n 1 31 GLY n 1 32 THR n 1 33 LYS n 1 34 LEU n 1 35 ASP n 1 36 ASP n 1 37 ASP n 1 38 PHE n 1 39 LYS n 1 40 GLU n 1 41 MSE n 1 42 GLU n 1 43 ARG n 1 44 LYS n 1 45 VAL n 1 46 ASP n 1 47 VAL n 1 48 THR n 1 49 SER n 1 50 ARG n 1 51 ALA n 1 52 VAL n 1 53 MSE n 1 54 GLU n 1 55 ILE n 1 56 MSE n 1 57 THR n 1 58 LYS n 1 59 THR n 1 60 ILE n 1 61 GLU n 1 62 TYR n 1 63 LEU n 1 64 ALA n 1 65 HIS n 1 66 LEU n 1 67 SER n 1 68 SER n 1 69 LEU n 1 70 LEU n 1 71 GLN n 1 72 ALA n 1 73 GLU n 1 74 ALA n 1 75 LEU n 1 76 LEU n 1 77 ALA n 1 78 GLU n 1 79 ALA n 1 80 MSE n 1 81 LEU n 1 82 LYS n 1 83 PHE n 1 84 GLY n 1 85 ARG n 1 86 GLU n 1 87 LEU n 1 88 GLY n 1 89 ASP n 1 90 ASP n 1 91 CYS n 1 92 ASN n 1 93 PHE n 1 94 GLY n 1 95 PRO n 1 96 ALA n 1 97 LEU n 1 98 GLY n 1 99 GLU n 1 100 VAL n 1 101 GLY n 1 102 GLU n 1 103 ALA n 1 104 MSE n 1 105 ARG n 1 106 GLU n 1 107 LEU n 1 108 SER n 1 109 GLU n 1 110 VAL n 1 111 LYS n 1 112 ASP n 1 113 SER n 1 114 LEU n 1 115 ASP n 1 116 ILE n 1 117 GLU n 1 118 VAL n 1 119 LYS n 1 120 GLN n 1 121 ASN n 1 122 PHE n 1 123 ILE n 1 124 ASP n 1 125 PRO n 1 126 LEU n 1 127 GLN n 1 128 ASN n 1 129 LEU n 1 130 HIS n 1 131 ASP n 1 132 LYS n 1 133 ASP n 1 134 LEU n 1 135 ARG n 1 136 GLU n 1 137 ILE n 1 138 GLN n 1 139 HIS n 1 140 HIS n 1 141 LEU n 1 142 LYS n 1 143 LYS n 1 144 LEU n 1 145 GLU n 1 146 GLY n 1 147 ARG n 1 148 ARG n 1 149 LEU n 1 150 ASP n 1 151 PHE n 1 152 ASP n 1 153 TYR n 1 154 LYS n 1 155 LYS n 1 156 LYS n 1 157 ARG n 1 158 GLN n 1 159 GLY n 1 160 LYS n 1 161 ILE n 1 162 PRO n 1 163 ASP n 1 164 GLU n 1 165 GLU n 1 166 LEU n 1 167 ARG n 1 168 GLN n 1 169 ALA n 1 170 LEU n 1 171 GLU n 1 172 LYS n 1 173 PHE n 1 174 ASP n 1 175 GLU n 1 176 SER n 1 177 LYS n 1 178 GLU n 1 179 ILE n 1 180 ALA n 1 181 GLU n 1 182 SER n 1 183 SER n 1 184 MSE n 1 185 PHE n 1 186 ASN n 1 187 LEU n 1 188 LEU n 1 189 GLU n 1 190 MSE n 1 191 ASP n 1 192 ILE n 1 193 GLU n 1 194 GLN n 1 195 VAL n 1 196 SER n 1 197 GLN n 1 198 LEU n 1 199 SER n 1 200 ALA n 1 201 LEU n 1 202 VAL n 1 203 GLN n 1 204 ALA n 1 205 GLN n 1 206 LEU n 1 207 GLU n 1 208 TYR n 1 209 HIS n 1 210 LYS n 1 211 GLN n 1 212 ALA n 1 213 VAL n 1 214 GLN n 1 215 ILE n 1 216 LEU n 1 217 GLN n 1 218 GLN n 1 219 VAL n 1 220 THR n 1 221 VAL n 1 222 ARG n 1 223 LEU n 1 224 GLU n 1 225 GLU n 1 226 ARG n 1 227 ILE n 1 228 ARG n 1 229 GLN n 1 230 ALA n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? 6 63 human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 'B834(DE3)pLysS' ? ? ? ? ? ? ? plasmid ? ? ? pGEX6p3 ? ? 1 2 sample ? 72 230 human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? 'B834(DE3)pLysS' ? ? ? ? ? ? ? plasmid ? ? ? pGEX6p3 ? ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SH32_HUMAN _struct_ref.pdbx_db_accession Q99962 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQ EKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKK LEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRL EERIRQA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1X04 A 6 ? 63 ? Q99962 1 ? 58 ? 1 58 2 1 1X04 A 72 ? 230 ? Q99962 89 ? 247 ? 67 225 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1X04 GLY A 1 ? UNP Q99962 ? ? LINKER -4 1 1 1X04 PRO A 2 ? UNP Q99962 ? ? LINKER -3 2 1 1X04 LEU A 3 ? UNP Q99962 ? ? LINKER -2 3 1 1X04 GLY A 4 ? UNP Q99962 ? ? LINKER -1 4 1 1X04 SER A 5 ? UNP Q99962 ? ? LINKER 0 5 1 1X04 MSE A 6 ? UNP Q99962 MET 1 'MODIFIED RESIDUE' 1 6 1 1X04 MSE A 41 ? UNP Q99962 MET 36 'MODIFIED RESIDUE' 36 7 1 1X04 MSE A 53 ? UNP Q99962 MET 48 'MODIFIED RESIDUE' 48 8 1 1X04 MSE A 56 ? UNP Q99962 MET 51 'MODIFIED RESIDUE' 51 9 1 1X04 ALA A 64 ? UNP Q99962 ? ? LINKER 59 10 1 1X04 HIS A 65 ? UNP Q99962 ? ? LINKER 60 11 1 1X04 LEU A 66 ? UNP Q99962 ? ? LINKER 61 12 1 1X04 SER A 67 ? UNP Q99962 ? ? LINKER 62 13 1 1X04 SER A 68 ? UNP Q99962 ? ? LINKER 63 14 1 1X04 LEU A 69 ? UNP Q99962 ? ? LINKER 64 15 1 1X04 LEU A 70 ? UNP Q99962 ? ? LINKER 65 16 1 1X04 GLN A 71 ? UNP Q99962 ? ? LINKER 66 17 1 1X04 MSE A 80 ? UNP Q99962 MET 97 'MODIFIED RESIDUE' 75 18 1 1X04 MSE A 104 ? UNP Q99962 MET 121 'MODIFIED RESIDUE' 99 19 1 1X04 MSE A 184 ? UNP Q99962 MET 201 'MODIFIED RESIDUE' 179 20 1 1X04 MSE A 190 ? UNP Q99962 MET 207 'MODIFIED RESIDUE' 185 21 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1X04 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 7.67 _exptl_crystal.density_percent_sol 83.96 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method MICRODIALYSIS _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pdbx_details 'NaCl, ethylene glycol, glycerol, benzamizine/HCl, Tris, DTT, pH 8.0, MICRODIALYSIS, temperature 277K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 90 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'RIGAKU JUPITER' _diffrn_detector.pdbx_collection_date 2004-11-27 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator Diamond _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL45PX' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL45PX _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.0 # _reflns.entry_id 1X04 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 2.9 _reflns.d_resolution_low 20 _reflns.number_all 17816 _reflns.number_obs 17780 _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rmerge_I_obs 0.074 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 20.7 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.9 _reflns_shell.d_res_low 3.0 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.35 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 5.5 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1782 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1X04 _refine.ls_d_res_high 2.9 _refine.ls_d_res_low 20 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_ls_sigma_I 0 _refine.ls_number_reflns_all 17862 _refine.ls_number_reflns_obs 17773 _refine.ls_number_reflns_R_free 921 _refine.ls_percent_reflns_obs 99.5 _refine.ls_R_factor_all 0.24 _refine.ls_R_factor_obs 0.24 _refine.ls_R_factor_R_work 0.238 _refine.ls_R_factor_R_free 0.269 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_mean 74.8 _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1X04 _refine_analyze.Luzzati_coordinate_error_obs 0.45 _refine_analyze.Luzzati_sigma_a_obs 0.65 _refine_analyze.Luzzati_d_res_low_obs 5.0 _refine_analyze.Luzzati_coordinate_error_free 0.52 _refine_analyze.Luzzati_sigma_a_free 0.73 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1622 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1622 _refine_hist.d_res_high 2.9 _refine_hist.d_res_low 20 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.0072 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.10 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.d_res_high 2.9 _refine_ls_shell.d_res_low 3.0 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.R_factor_R_work 0.4065 _refine_ls_shell.percent_reflns_obs 96.54 _refine_ls_shell.R_factor_R_free 0.4612 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 91 _refine_ls_shell.number_reflns_obs 1641 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 1X04 _struct.title 'Crystal structure of endophilin BAR domain (mutant)' _struct.pdbx_descriptor 'SH3-containing GRB2-like protein 2 (E.C.2.3.1.-)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1X04 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'BAR domain, TRANSFERASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details 'The biological assembly is a dimer generated by the two fold axis' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 35 ? LEU A 87 ? ASP A 30 LEU A 82 1 ? 53 HELX_P HELX_P2 2 ASN A 92 ? PHE A 122 ? ASN A 87 PHE A 117 1 ? 31 HELX_P HELX_P3 3 PHE A 122 ? LYS A 132 ? PHE A 117 LYS A 127 1 ? 11 HELX_P HELX_P4 4 LYS A 132 ? ARG A 157 ? LYS A 127 ARG A 152 1 ? 26 HELX_P HELX_P5 5 PRO A 162 ? MSE A 190 ? PRO A 157 MSE A 185 1 ? 29 HELX_P HELX_P6 6 ASP A 191 ? ILE A 227 ? ASP A 186 ILE A 222 1 ? 37 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A GLU 40 C ? ? ? 1_555 A MSE 41 N ? ? A GLU 35 A MSE 36 1_555 ? ? ? ? ? ? ? 1.324 ? covale2 covale ? ? A MSE 41 C ? ? ? 1_555 A GLU 42 N ? ? A MSE 36 A GLU 37 1_555 ? ? ? ? ? ? ? 1.328 ? covale3 covale ? ? A VAL 52 C ? ? ? 1_555 A MSE 53 N ? ? A VAL 47 A MSE 48 1_555 ? ? ? ? ? ? ? 1.324 ? covale4 covale ? ? A MSE 53 C ? ? ? 1_555 A GLU 54 N ? ? A MSE 48 A GLU 49 1_555 ? ? ? ? ? ? ? 1.326 ? covale5 covale ? ? A ILE 55 C ? ? ? 1_555 A MSE 56 N ? ? A ILE 50 A MSE 51 1_555 ? ? ? ? ? ? ? 1.320 ? covale6 covale ? ? A MSE 56 C ? ? ? 1_555 A THR 57 N ? ? A MSE 51 A THR 52 1_555 ? ? ? ? ? ? ? 1.325 ? covale7 covale ? ? A ALA 79 C ? ? ? 1_555 A MSE 80 N ? ? A ALA 74 A MSE 75 1_555 ? ? ? ? ? ? ? 1.327 ? covale8 covale ? ? A MSE 80 C ? ? ? 1_555 A LEU 81 N ? ? A MSE 75 A LEU 76 1_555 ? ? ? ? ? ? ? 1.329 ? covale9 covale ? ? A ALA 103 C ? ? ? 1_555 A MSE 104 N ? ? A ALA 98 A MSE 99 1_555 ? ? ? ? ? ? ? 1.330 ? covale10 covale ? ? A MSE 104 C ? ? ? 1_555 A ARG 105 N ? ? A MSE 99 A ARG 100 1_555 ? ? ? ? ? ? ? 1.329 ? covale11 covale ? ? A SER 183 C ? ? ? 1_555 A MSE 184 N ? ? A SER 178 A MSE 179 1_555 ? ? ? ? ? ? ? 1.330 ? covale12 covale ? ? A MSE 184 C ? ? ? 1_555 A PHE 185 N ? ? A MSE 179 A PHE 180 1_555 ? ? ? ? ? ? ? 1.328 ? covale13 covale ? ? A GLU 189 C ? ? ? 1_555 A MSE 190 N ? ? A GLU 184 A MSE 185 1_555 ? ? ? ? ? ? ? 1.328 ? covale14 covale ? ? A MSE 190 C ? ? ? 1_555 A ASP 191 N ? ? A MSE 185 A ASP 186 1_555 ? ? ? ? ? ? ? 1.326 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1X04 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1X04 _atom_sites.fract_transf_matrix[1][1] 0.007747 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007747 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010208 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -4 ? ? ? A . n A 1 2 PRO 2 -3 ? ? ? A . n A 1 3 LEU 3 -2 ? ? ? A . n A 1 4 GLY 4 -1 ? ? ? A . n A 1 5 SER 5 0 ? ? ? A . n A 1 6 MSE 6 1 ? ? ? A . n A 1 7 SER 7 2 ? ? ? A . n A 1 8 VAL 8 3 ? ? ? A . n A 1 9 ALA 9 4 ? ? ? A . n A 1 10 GLY 10 5 ? ? ? A . n A 1 11 LEU 11 6 ? ? ? A . n A 1 12 LYS 12 7 ? ? ? A . n A 1 13 LYS 13 8 ? ? ? A . n A 1 14 GLN 14 9 ? ? ? A . n A 1 15 PHE 15 10 ? ? ? A . n A 1 16 HIS 16 11 ? ? ? A . n A 1 17 LYS 17 12 ? ? ? A . n A 1 18 ALA 18 13 ? ? ? A . n A 1 19 THR 19 14 ? ? ? A . n A 1 20 GLN 20 15 ? ? ? A . n A 1 21 LYS 21 16 ? ? ? A . n A 1 22 VAL 22 17 ? ? ? A . n A 1 23 SER 23 18 ? ? ? A . n A 1 24 GLU 24 19 ? ? ? A . n A 1 25 LYS 25 20 ? ? ? A . n A 1 26 VAL 26 21 ? ? ? A . n A 1 27 GLY 27 22 ? ? ? A . n A 1 28 GLY 28 23 ? ? ? A . n A 1 29 ALA 29 24 ? ? ? A . n A 1 30 GLU 30 25 ? ? ? A . n A 1 31 GLY 31 26 26 GLY GLY A . n A 1 32 THR 32 27 27 THR THR A . n A 1 33 LYS 33 28 28 LYS LYS A . n A 1 34 LEU 34 29 29 LEU LEU A . n A 1 35 ASP 35 30 30 ASP ASP A . n A 1 36 ASP 36 31 31 ASP ASP A . n A 1 37 ASP 37 32 32 ASP ASP A . n A 1 38 PHE 38 33 33 PHE PHE A . n A 1 39 LYS 39 34 34 LYS LYS A . n A 1 40 GLU 40 35 35 GLU GLU A . n A 1 41 MSE 41 36 36 MSE MSE A . n A 1 42 GLU 42 37 37 GLU GLU A . n A 1 43 ARG 43 38 38 ARG ARG A . n A 1 44 LYS 44 39 39 LYS LYS A . n A 1 45 VAL 45 40 40 VAL VAL A . n A 1 46 ASP 46 41 41 ASP ASP A . n A 1 47 VAL 47 42 42 VAL VAL A . n A 1 48 THR 48 43 43 THR THR A . n A 1 49 SER 49 44 44 SER SER A . n A 1 50 ARG 50 45 45 ARG ARG A . n A 1 51 ALA 51 46 46 ALA ALA A . n A 1 52 VAL 52 47 47 VAL VAL A . n A 1 53 MSE 53 48 48 MSE MSE A . n A 1 54 GLU 54 49 49 GLU GLU A . n A 1 55 ILE 55 50 50 ILE ILE A . n A 1 56 MSE 56 51 51 MSE MSE A . n A 1 57 THR 57 52 52 THR THR A . n A 1 58 LYS 58 53 53 LYS LYS A . n A 1 59 THR 59 54 54 THR THR A . n A 1 60 ILE 60 55 55 ILE ILE A . n A 1 61 GLU 61 56 56 GLU GLU A . n A 1 62 TYR 62 57 57 TYR TYR A . n A 1 63 LEU 63 58 58 LEU LEU A . n A 1 64 ALA 64 59 59 ALA ALA A . n A 1 65 HIS 65 60 60 HIS HIS A . n A 1 66 LEU 66 61 61 LEU LEU A . n A 1 67 SER 67 62 62 SER SER A . n A 1 68 SER 68 63 63 SER SER A . n A 1 69 LEU 69 64 64 LEU LEU A . n A 1 70 LEU 70 65 65 LEU LEU A . n A 1 71 GLN 71 66 66 GLN GLN A . n A 1 72 ALA 72 67 67 ALA ALA A . n A 1 73 GLU 73 68 68 GLU GLU A . n A 1 74 ALA 74 69 69 ALA ALA A . n A 1 75 LEU 75 70 70 LEU LEU A . n A 1 76 LEU 76 71 71 LEU LEU A . n A 1 77 ALA 77 72 72 ALA ALA A . n A 1 78 GLU 78 73 73 GLU GLU A . n A 1 79 ALA 79 74 74 ALA ALA A . n A 1 80 MSE 80 75 75 MSE MSE A . n A 1 81 LEU 81 76 76 LEU LEU A . n A 1 82 LYS 82 77 77 LYS LYS A . n A 1 83 PHE 83 78 78 PHE PHE A . n A 1 84 GLY 84 79 79 GLY GLY A . n A 1 85 ARG 85 80 80 ARG ARG A . n A 1 86 GLU 86 81 81 GLU GLU A . n A 1 87 LEU 87 82 82 LEU LEU A . n A 1 88 GLY 88 83 83 GLY GLY A . n A 1 89 ASP 89 84 84 ASP ASP A . n A 1 90 ASP 90 85 85 ASP ASP A . n A 1 91 CYS 91 86 86 CYS CYS A . n A 1 92 ASN 92 87 87 ASN ASN A . n A 1 93 PHE 93 88 88 PHE PHE A . n A 1 94 GLY 94 89 89 GLY GLY A . n A 1 95 PRO 95 90 90 PRO PRO A . n A 1 96 ALA 96 91 91 ALA ALA A . n A 1 97 LEU 97 92 92 LEU LEU A . n A 1 98 GLY 98 93 93 GLY GLY A . n A 1 99 GLU 99 94 94 GLU GLU A . n A 1 100 VAL 100 95 95 VAL VAL A . n A 1 101 GLY 101 96 96 GLY GLY A . n A 1 102 GLU 102 97 97 GLU GLU A . n A 1 103 ALA 103 98 98 ALA ALA A . n A 1 104 MSE 104 99 99 MSE MSE A . n A 1 105 ARG 105 100 100 ARG ARG A . n A 1 106 GLU 106 101 101 GLU GLU A . n A 1 107 LEU 107 102 102 LEU LEU A . n A 1 108 SER 108 103 103 SER SER A . n A 1 109 GLU 109 104 104 GLU GLU A . n A 1 110 VAL 110 105 105 VAL VAL A . n A 1 111 LYS 111 106 106 LYS LYS A . n A 1 112 ASP 112 107 107 ASP ASP A . n A 1 113 SER 113 108 108 SER SER A . n A 1 114 LEU 114 109 109 LEU LEU A . n A 1 115 ASP 115 110 110 ASP ASP A . n A 1 116 ILE 116 111 111 ILE ILE A . n A 1 117 GLU 117 112 112 GLU GLU A . n A 1 118 VAL 118 113 113 VAL VAL A . n A 1 119 LYS 119 114 114 LYS LYS A . n A 1 120 GLN 120 115 115 GLN GLN A . n A 1 121 ASN 121 116 116 ASN ASN A . n A 1 122 PHE 122 117 117 PHE PHE A . n A 1 123 ILE 123 118 118 ILE ILE A . n A 1 124 ASP 124 119 119 ASP ASP A . n A 1 125 PRO 125 120 120 PRO PRO A . n A 1 126 LEU 126 121 121 LEU LEU A . n A 1 127 GLN 127 122 122 GLN GLN A . n A 1 128 ASN 128 123 123 ASN ASN A . n A 1 129 LEU 129 124 124 LEU LEU A . n A 1 130 HIS 130 125 125 HIS HIS A . n A 1 131 ASP 131 126 126 ASP ASP A . n A 1 132 LYS 132 127 127 LYS LYS A . n A 1 133 ASP 133 128 128 ASP ASP A . n A 1 134 LEU 134 129 129 LEU LEU A . n A 1 135 ARG 135 130 130 ARG ARG A . n A 1 136 GLU 136 131 131 GLU GLU A . n A 1 137 ILE 137 132 132 ILE ILE A . n A 1 138 GLN 138 133 133 GLN GLN A . n A 1 139 HIS 139 134 134 HIS HIS A . n A 1 140 HIS 140 135 135 HIS HIS A . n A 1 141 LEU 141 136 136 LEU LEU A . n A 1 142 LYS 142 137 137 LYS LYS A . n A 1 143 LYS 143 138 138 LYS LYS A . n A 1 144 LEU 144 139 139 LEU LEU A . n A 1 145 GLU 145 140 140 GLU GLU A . n A 1 146 GLY 146 141 141 GLY GLY A . n A 1 147 ARG 147 142 142 ARG ARG A . n A 1 148 ARG 148 143 143 ARG ARG A . n A 1 149 LEU 149 144 144 LEU LEU A . n A 1 150 ASP 150 145 145 ASP ASP A . n A 1 151 PHE 151 146 146 PHE PHE A . n A 1 152 ASP 152 147 147 ASP ASP A . n A 1 153 TYR 153 148 148 TYR TYR A . n A 1 154 LYS 154 149 149 LYS LYS A . n A 1 155 LYS 155 150 150 LYS LYS A . n A 1 156 LYS 156 151 151 LYS LYS A . n A 1 157 ARG 157 152 152 ARG ARG A . n A 1 158 GLN 158 153 153 GLN GLN A . n A 1 159 GLY 159 154 154 GLY GLY A . n A 1 160 LYS 160 155 155 LYS LYS A . n A 1 161 ILE 161 156 156 ILE ILE A . n A 1 162 PRO 162 157 157 PRO PRO A . n A 1 163 ASP 163 158 158 ASP ASP A . n A 1 164 GLU 164 159 159 GLU GLU A . n A 1 165 GLU 165 160 160 GLU GLU A . n A 1 166 LEU 166 161 161 LEU LEU A . n A 1 167 ARG 167 162 162 ARG ARG A . n A 1 168 GLN 168 163 163 GLN GLN A . n A 1 169 ALA 169 164 164 ALA ALA A . n A 1 170 LEU 170 165 165 LEU LEU A . n A 1 171 GLU 171 166 166 GLU GLU A . n A 1 172 LYS 172 167 167 LYS LYS A . n A 1 173 PHE 173 168 168 PHE PHE A . n A 1 174 ASP 174 169 169 ASP ASP A . n A 1 175 GLU 175 170 170 GLU GLU A . n A 1 176 SER 176 171 171 SER SER A . n A 1 177 LYS 177 172 172 LYS LYS A . n A 1 178 GLU 178 173 173 GLU GLU A . n A 1 179 ILE 179 174 174 ILE ILE A . n A 1 180 ALA 180 175 175 ALA ALA A . n A 1 181 GLU 181 176 176 GLU GLU A . n A 1 182 SER 182 177 177 SER SER A . n A 1 183 SER 183 178 178 SER SER A . n A 1 184 MSE 184 179 179 MSE MSE A . n A 1 185 PHE 185 180 180 PHE PHE A . n A 1 186 ASN 186 181 181 ASN ASN A . n A 1 187 LEU 187 182 182 LEU LEU A . n A 1 188 LEU 188 183 183 LEU LEU A . n A 1 189 GLU 189 184 184 GLU GLU A . n A 1 190 MSE 190 185 185 MSE MSE A . n A 1 191 ASP 191 186 186 ASP ASP A . n A 1 192 ILE 192 187 187 ILE ILE A . n A 1 193 GLU 193 188 188 GLU GLU A . n A 1 194 GLN 194 189 189 GLN GLN A . n A 1 195 VAL 195 190 190 VAL VAL A . n A 1 196 SER 196 191 191 SER SER A . n A 1 197 GLN 197 192 192 GLN GLN A . n A 1 198 LEU 198 193 193 LEU LEU A . n A 1 199 SER 199 194 194 SER SER A . n A 1 200 ALA 200 195 195 ALA ALA A . n A 1 201 LEU 201 196 196 LEU LEU A . n A 1 202 VAL 202 197 197 VAL VAL A . n A 1 203 GLN 203 198 198 GLN GLN A . n A 1 204 ALA 204 199 199 ALA ALA A . n A 1 205 GLN 205 200 200 GLN GLN A . n A 1 206 LEU 206 201 201 LEU LEU A . n A 1 207 GLU 207 202 202 GLU GLU A . n A 1 208 TYR 208 203 203 TYR TYR A . n A 1 209 HIS 209 204 204 HIS HIS A . n A 1 210 LYS 210 205 205 LYS LYS A . n A 1 211 GLN 211 206 206 GLN GLN A . n A 1 212 ALA 212 207 207 ALA ALA A . n A 1 213 VAL 213 208 208 VAL VAL A . n A 1 214 GLN 214 209 209 GLN GLN A . n A 1 215 ILE 215 210 210 ILE ILE A . n A 1 216 LEU 216 211 211 LEU LEU A . n A 1 217 GLN 217 212 212 GLN GLN A . n A 1 218 GLN 218 213 213 GLN GLN A . n A 1 219 VAL 219 214 214 VAL VAL A . n A 1 220 THR 220 215 215 THR THR A . n A 1 221 VAL 221 216 216 VAL VAL A . n A 1 222 ARG 222 217 217 ARG ARG A . n A 1 223 LEU 223 218 218 LEU LEU A . n A 1 224 GLU 224 219 219 GLU GLU A . n A 1 225 GLU 225 220 220 GLU GLU A . n A 1 226 ARG 226 221 221 ARG ARG A . n A 1 227 ILE 227 222 222 ILE ILE A . n A 1 228 ARG 228 223 223 ARG ARG A . n A 1 229 GLN 229 224 224 GLN GLN A . n A 1 230 ALA 230 225 225 ALA ALA A . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 41 A MSE 36 ? MET SELENOMETHIONINE 2 A MSE 53 A MSE 48 ? MET SELENOMETHIONINE 3 A MSE 56 A MSE 51 ? MET SELENOMETHIONINE 4 A MSE 80 A MSE 75 ? MET SELENOMETHIONINE 5 A MSE 104 A MSE 99 ? MET SELENOMETHIONINE 6 A MSE 184 A MSE 179 ? MET SELENOMETHIONINE 7 A MSE 190 A MSE 185 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5930 ? 1 MORE -49 ? 1 'SSA (A^2)' 20370 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 129.0770000000 0.0000000000 -1.0000000000 0.0000000000 129.0770000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-05-02 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-08-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' 5 4 'Structure model' 'Source and taxonomy' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' entity_src_gen 2 4 'Structure model' software # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 SCALEPACK 'data scaling' . ? 2 MOLREP phasing . ? 3 CNS refinement . ? 4 HKL-2000 'data reduction' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 77 ? ? -71.89 -70.46 2 1 ARG A 80 ? ? -77.56 -72.24 3 1 CYS A 86 ? ? -111.10 -149.83 4 1 PHE A 117 ? ? -136.18 -56.27 5 1 LYS A 127 ? ? -113.94 -84.28 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -4 ? A GLY 1 2 1 Y 1 A PRO -3 ? A PRO 2 3 1 Y 1 A LEU -2 ? A LEU 3 4 1 Y 1 A GLY -1 ? A GLY 4 5 1 Y 1 A SER 0 ? A SER 5 6 1 Y 1 A MSE 1 ? A MSE 6 7 1 Y 1 A SER 2 ? A SER 7 8 1 Y 1 A VAL 3 ? A VAL 8 9 1 Y 1 A ALA 4 ? A ALA 9 10 1 Y 1 A GLY 5 ? A GLY 10 11 1 Y 1 A LEU 6 ? A LEU 11 12 1 Y 1 A LYS 7 ? A LYS 12 13 1 Y 1 A LYS 8 ? A LYS 13 14 1 Y 1 A GLN 9 ? A GLN 14 15 1 Y 1 A PHE 10 ? A PHE 15 16 1 Y 1 A HIS 11 ? A HIS 16 17 1 Y 1 A LYS 12 ? A LYS 17 18 1 Y 1 A ALA 13 ? A ALA 18 19 1 Y 1 A THR 14 ? A THR 19 20 1 Y 1 A GLN 15 ? A GLN 20 21 1 Y 1 A LYS 16 ? A LYS 21 22 1 Y 1 A VAL 17 ? A VAL 22 23 1 Y 1 A SER 18 ? A SER 23 24 1 Y 1 A GLU 19 ? A GLU 24 25 1 Y 1 A LYS 20 ? A LYS 25 26 1 Y 1 A VAL 21 ? A VAL 26 27 1 Y 1 A GLY 22 ? A GLY 27 28 1 Y 1 A GLY 23 ? A GLY 28 29 1 Y 1 A ALA 24 ? A ALA 29 30 1 Y 1 A GLU 25 ? A GLU 30 #