data_1X4D # _entry.id 1X4D # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1X4D pdb_00001x4d 10.2210/pdb1x4d/pdb RCSB RCSB024363 ? ? WWPDB D_1000024363 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmt008001240.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1X4D _pdbx_database_status.recvd_initial_deposition_date 2005-05-14 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'He, F.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Shirouzu, M.' 5 'Terada, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of RRM domain in Matrin 3' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'He, F.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Shirouzu, M.' 5 ? primary 'Terada, T.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Matrin 3' _entity.formula_weight 11351.972 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation S15R _entity.pdbx_fragment 'RRM domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGQKGRVETRRVVHIMDFQRGKNLRYQLLQLVEPFGVISNHLILNKINEAFIEMATTEDAQAAVDYYTTTPALVF GKPVRVHLSQKYKRIKSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGQKGRVETRRVVHIMDFQRGKNLRYQLLQLVEPFGVISNHLILNKINEAFIEMATTEDAQAAVDYYTTTPALVF GKPVRVHLSQKYKRIKSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmt008001240.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLN n 1 9 LYS n 1 10 GLY n 1 11 ARG n 1 12 VAL n 1 13 GLU n 1 14 THR n 1 15 ARG n 1 16 ARG n 1 17 VAL n 1 18 VAL n 1 19 HIS n 1 20 ILE n 1 21 MET n 1 22 ASP n 1 23 PHE n 1 24 GLN n 1 25 ARG n 1 26 GLY n 1 27 LYS n 1 28 ASN n 1 29 LEU n 1 30 ARG n 1 31 TYR n 1 32 GLN n 1 33 LEU n 1 34 LEU n 1 35 GLN n 1 36 LEU n 1 37 VAL n 1 38 GLU n 1 39 PRO n 1 40 PHE n 1 41 GLY n 1 42 VAL n 1 43 ILE n 1 44 SER n 1 45 ASN n 1 46 HIS n 1 47 LEU n 1 48 ILE n 1 49 LEU n 1 50 ASN n 1 51 LYS n 1 52 ILE n 1 53 ASN n 1 54 GLU n 1 55 ALA n 1 56 PHE n 1 57 ILE n 1 58 GLU n 1 59 MET n 1 60 ALA n 1 61 THR n 1 62 THR n 1 63 GLU n 1 64 ASP n 1 65 ALA n 1 66 GLN n 1 67 ALA n 1 68 ALA n 1 69 VAL n 1 70 ASP n 1 71 TYR n 1 72 TYR n 1 73 THR n 1 74 THR n 1 75 THR n 1 76 PRO n 1 77 ALA n 1 78 LEU n 1 79 VAL n 1 80 PHE n 1 81 GLY n 1 82 LYS n 1 83 PRO n 1 84 VAL n 1 85 ARG n 1 86 VAL n 1 87 HIS n 1 88 LEU n 1 89 SER n 1 90 GLN n 1 91 LYS n 1 92 TYR n 1 93 LYS n 1 94 ARG n 1 95 ILE n 1 96 LYS n 1 97 SER n 1 98 GLY n 1 99 PRO n 1 100 SER n 1 101 SER n 1 102 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene Matr3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 040809-03 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MATR3_MOUSE _struct_ref.pdbx_db_accession Q8K310 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QKGRVETSRVVHIMDFQRGKNLRYQLLQLVEPFGVISNHLILNKINEAFIEMATTEDAQAAVDYYTTTPALVFGKPVRVH LSQKYKRIK ; _struct_ref.pdbx_align_begin 390 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1X4D _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 96 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8K310 _struct_ref_seq.db_align_beg 390 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 478 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 96 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1X4D GLY A 1 ? UNP Q8K310 ? ? 'cloning artifact' 1 1 1 1X4D SER A 2 ? UNP Q8K310 ? ? 'cloning artifact' 2 2 1 1X4D SER A 3 ? UNP Q8K310 ? ? 'cloning artifact' 3 3 1 1X4D GLY A 4 ? UNP Q8K310 ? ? 'cloning artifact' 4 4 1 1X4D SER A 5 ? UNP Q8K310 ? ? 'cloning artifact' 5 5 1 1X4D SER A 6 ? UNP Q8K310 ? ? 'cloning artifact' 6 6 1 1X4D GLY A 7 ? UNP Q8K310 ? ? 'cloning artifact' 7 7 1 1X4D ARG A 15 ? UNP Q8K310 SER 397 'engineered mutation' 15 8 1 1X4D SER A 97 ? UNP Q8K310 ? ? 'cloning artifact' 97 9 1 1X4D GLY A 98 ? UNP Q8K310 ? ? 'cloning artifact' 98 10 1 1X4D PRO A 99 ? UNP Q8K310 ? ? 'cloning artifact' 99 11 1 1X4D SER A 100 ? UNP Q8K310 ? ? 'cloning artifact' 100 12 1 1X4D SER A 101 ? UNP Q8K310 ? ? 'cloning artifact' 101 13 1 1X4D GLY A 102 ? UNP Q8K310 ? ? 'cloning artifact' 102 14 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8mM U-15,13C; 20mM phosphate buffer NA; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1X4D _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1X4D _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1X4D _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20031121 Delaglio,F. 2 'data analysis' NMRView 5.0.4 Johnson,B.A. 3 'data analysis' KUJIRA 0.863 Kobayashi,N. 4 'structure solution' CYANA 2.0.29 Guntert,P. 5 refinement CYANA 2.0.29 Guntert,P. 6 # _exptl.entry_id 1X4D _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1X4D _struct.title 'Solution structure of RRM domain in Matrin 3' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1X4D _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text ;structural genomics, RRM domain, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 29 ? LEU A 34 ? LEU A 29 LEU A 34 1 ? 6 HELX_P HELX_P2 2 GLU A 38 ? PHE A 40 ? GLU A 38 PHE A 40 5 ? 3 HELX_P HELX_P3 3 THR A 62 ? THR A 74 ? THR A 62 THR A 74 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 17 ? MET A 21 ? VAL A 17 MET A 21 A 2 ILE A 43 ? ILE A 48 ? ILE A 43 ILE A 48 A 3 ALA A 55 ? MET A 59 ? ALA A 55 MET A 59 A 4 LEU A 78 ? VAL A 79 ? LEU A 78 VAL A 79 B 1 LYS A 82 ? PRO A 83 ? LYS A 82 PRO A 83 B 2 ARG A 85 ? SER A 89 ? ARG A 85 SER A 89 # _database_PDB_matrix.entry_id 1X4D _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1X4D _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 GLY 102 102 102 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-14 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; 700 ;SHEET DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -145.04 42.08 2 1 ARG A 15 ? ? 43.40 -168.82 3 1 PRO A 39 ? ? -69.83 2.21 4 1 ASN A 45 ? ? -172.71 127.98 5 1 ASN A 50 ? ? -95.93 33.10 6 1 LEU A 88 ? ? -113.98 76.54 7 1 GLN A 90 ? ? -152.90 71.57 8 1 TYR A 92 ? ? 60.95 75.95 9 1 ILE A 95 ? ? -35.92 -36.95 10 1 SER A 101 ? ? 178.08 81.80 11 2 SER A 2 ? ? 62.37 81.72 12 2 SER A 5 ? ? 63.02 124.86 13 2 SER A 6 ? ? -58.47 107.73 14 2 GLN A 8 ? ? -174.75 -51.95 15 2 ARG A 15 ? ? -46.03 164.75 16 2 PRO A 39 ? ? -69.78 2.02 17 2 ASN A 45 ? ? -174.71 128.07 18 2 ASN A 50 ? ? -94.56 41.18 19 2 LYS A 51 ? ? -130.55 -45.72 20 2 ASN A 53 ? ? -86.35 48.88 21 2 LYS A 91 ? ? 62.69 151.07 22 2 TYR A 92 ? ? -138.15 -36.17 23 2 LYS A 93 ? ? 163.25 35.08 24 2 ARG A 94 ? ? 60.82 119.35 25 2 LYS A 96 ? ? -179.41 125.81 26 3 SER A 2 ? ? 61.59 114.51 27 3 ARG A 11 ? ? 178.70 156.45 28 3 ARG A 15 ? ? -34.46 150.44 29 3 ASP A 22 ? ? 47.85 21.33 30 3 ARG A 30 ? ? -39.93 -25.49 31 3 PRO A 39 ? ? -69.67 0.38 32 3 ASN A 45 ? ? -173.83 128.02 33 3 ASN A 50 ? ? -91.31 32.72 34 3 ASN A 53 ? ? -90.67 49.65 35 3 LEU A 88 ? ? -110.98 71.24 36 3 SER A 89 ? ? -57.58 175.50 37 3 LYS A 91 ? ? 61.18 149.98 38 3 TYR A 92 ? ? 171.26 -170.89 39 3 LYS A 93 ? ? -82.79 40.00 40 3 ARG A 94 ? ? 34.77 84.66 41 3 LYS A 96 ? ? -165.89 -62.97 42 3 PRO A 99 ? ? -69.71 89.36 43 3 SER A 101 ? ? -155.93 -58.76 44 4 SER A 2 ? ? 75.22 -69.81 45 4 SER A 5 ? ? 175.70 106.51 46 4 ARG A 15 ? ? -40.05 154.32 47 4 PRO A 39 ? ? -69.76 2.04 48 4 ASN A 45 ? ? -173.92 127.87 49 4 ASN A 50 ? ? -96.77 38.88 50 4 ASN A 53 ? ? -93.60 50.06 51 4 GLN A 90 ? ? -149.97 54.18 52 4 LYS A 91 ? ? -179.70 121.30 53 4 TYR A 92 ? ? 173.17 81.79 54 4 ARG A 94 ? ? -172.18 -35.16 55 4 ILE A 95 ? ? -38.48 96.89 56 4 LYS A 96 ? ? 66.62 104.85 57 4 SER A 97 ? ? 179.85 -46.50 58 4 PRO A 99 ? ? -69.78 97.70 59 4 SER A 100 ? ? -172.32 102.59 60 5 SER A 5 ? ? -177.84 101.47 61 5 SER A 6 ? ? 172.31 160.74 62 5 LYS A 9 ? ? -95.42 41.84 63 5 ARG A 15 ? ? -42.40 162.35 64 5 ARG A 30 ? ? -38.82 -26.56 65 5 PRO A 39 ? ? -69.76 1.79 66 5 ASN A 45 ? ? -173.65 128.02 67 5 ASN A 53 ? ? -91.34 51.06 68 5 GLN A 90 ? ? -154.71 74.60 69 5 TYR A 92 ? ? 56.98 79.68 70 5 ARG A 94 ? ? 63.33 95.67 71 5 LYS A 96 ? ? 49.47 92.31 72 5 PRO A 99 ? ? -69.82 99.51 73 6 SER A 2 ? ? 72.17 43.73 74 6 GLN A 8 ? ? -98.62 39.57 75 6 LYS A 9 ? ? -45.40 150.20 76 6 GLU A 13 ? ? -53.34 90.92 77 6 ARG A 15 ? ? -38.41 157.05 78 6 ASP A 22 ? ? 81.22 -14.58 79 6 LYS A 27 ? ? -126.64 -62.75 80 6 ASN A 28 ? ? -99.59 33.81 81 6 ARG A 30 ? ? -38.87 -28.22 82 6 PRO A 39 ? ? -69.86 0.64 83 6 ASN A 45 ? ? -175.05 127.81 84 6 ASN A 53 ? ? -99.23 52.12 85 6 SER A 89 ? ? -66.95 -156.26 86 6 LYS A 91 ? ? 61.66 -179.35 87 6 ILE A 95 ? ? 63.34 -74.21 88 6 SER A 100 ? ? -178.73 -66.35 89 7 SER A 2 ? ? 54.53 93.94 90 7 SER A 3 ? ? 55.56 85.07 91 7 GLN A 8 ? ? 65.75 104.74 92 7 ARG A 15 ? ? -42.98 159.42 93 7 ASP A 22 ? ? 83.70 -25.06 94 7 ARG A 30 ? ? -39.29 -32.58 95 7 PRO A 39 ? ? -69.77 2.02 96 7 ASN A 53 ? ? -95.45 51.36 97 7 SER A 89 ? ? -38.83 157.49 98 7 TYR A 92 ? ? 172.59 71.43 99 7 ARG A 94 ? ? -154.93 -41.70 100 7 ILE A 95 ? ? -34.29 115.53 101 7 LYS A 96 ? ? 44.63 94.82 102 7 SER A 97 ? ? -156.37 -56.54 103 8 SER A 5 ? ? 61.81 85.80 104 8 ARG A 11 ? ? 61.98 163.83 105 8 ARG A 15 ? ? -42.51 165.18 106 8 ARG A 30 ? ? -38.05 -27.55 107 8 PRO A 39 ? ? -69.73 1.68 108 8 ASN A 45 ? ? -176.81 128.06 109 8 ASN A 53 ? ? -88.59 47.59 110 8 GLN A 90 ? ? -157.54 71.14 111 8 TYR A 92 ? ? 61.74 80.42 112 8 SER A 101 ? ? 67.58 136.78 113 9 SER A 5 ? ? -53.05 107.34 114 9 GLU A 13 ? ? 34.65 87.85 115 9 ARG A 15 ? ? -36.15 153.02 116 9 LYS A 27 ? ? -123.69 -58.38 117 9 PRO A 39 ? ? -69.74 1.92 118 9 ASN A 45 ? ? -178.05 127.69 119 9 ASN A 50 ? ? -96.56 33.53 120 9 ASN A 53 ? ? -96.55 46.94 121 9 LEU A 88 ? ? -115.94 79.50 122 9 SER A 89 ? ? -72.25 -169.80 123 9 LYS A 91 ? ? 59.84 151.71 124 9 TYR A 92 ? ? 173.63 38.12 125 9 LYS A 93 ? ? 68.98 -70.32 126 9 ARG A 94 ? ? 178.54 172.75 127 9 ILE A 95 ? ? -143.39 -41.47 128 9 PRO A 99 ? ? -69.83 -179.43 129 10 SER A 3 ? ? 63.32 155.34 130 10 GLN A 8 ? ? -48.15 98.29 131 10 ARG A 15 ? ? -37.75 156.15 132 10 PRO A 39 ? ? -69.69 1.57 133 10 ASN A 45 ? ? -176.53 128.48 134 10 ASN A 53 ? ? -105.35 49.59 135 10 THR A 74 ? ? -130.66 -33.80 136 10 LEU A 88 ? ? -108.36 79.14 137 10 LYS A 91 ? ? 60.80 133.67 138 10 TYR A 92 ? ? 174.99 146.87 139 10 SER A 100 ? ? 70.66 37.64 140 10 SER A 101 ? ? 39.67 41.10 141 11 LYS A 9 ? ? -168.58 85.77 142 11 ARG A 15 ? ? -44.36 165.04 143 11 ARG A 30 ? ? -39.20 -37.33 144 11 PRO A 39 ? ? -69.79 2.12 145 11 ASN A 50 ? ? -96.86 41.89 146 11 LYS A 51 ? ? -130.97 -45.12 147 11 ASN A 53 ? ? -88.35 49.87 148 11 GLN A 90 ? ? 54.61 18.22 149 11 TYR A 92 ? ? 80.86 152.12 150 11 LYS A 93 ? ? -152.50 -39.21 151 11 ARG A 94 ? ? -47.40 89.54 152 11 LYS A 96 ? ? 52.60 97.16 153 11 SER A 97 ? ? -166.98 111.68 154 11 SER A 101 ? ? 63.21 119.08 155 12 SER A 6 ? ? -176.84 144.15 156 12 ARG A 15 ? ? 32.73 -149.12 157 12 ARG A 30 ? ? -38.76 -26.71 158 12 ASN A 45 ? ? -170.58 127.96 159 12 ASN A 53 ? ? -92.00 50.25 160 12 LEU A 88 ? ? -105.84 76.09 161 12 SER A 89 ? ? -69.35 -176.29 162 12 LYS A 91 ? ? 79.41 -162.54 163 12 LYS A 96 ? ? -174.04 94.13 164 12 SER A 100 ? ? -36.29 125.44 165 12 SER A 101 ? ? -160.22 107.53 166 13 SER A 6 ? ? -165.05 110.68 167 13 GLU A 13 ? ? 41.28 80.05 168 13 ARG A 15 ? ? -39.91 152.32 169 13 ARG A 30 ? ? -38.93 -27.06 170 13 PRO A 39 ? ? -69.80 1.66 171 13 ASN A 45 ? ? -176.75 128.08 172 13 ASN A 50 ? ? -92.78 36.16 173 13 ASN A 53 ? ? -98.04 49.23 174 13 GLN A 90 ? ? -149.63 29.79 175 13 TYR A 92 ? ? 62.47 140.94 176 13 ILE A 95 ? ? 60.93 143.58 177 13 LYS A 96 ? ? 40.59 91.58 178 13 SER A 101 ? ? 65.85 167.41 179 14 SER A 2 ? ? 60.12 119.63 180 14 SER A 5 ? ? -164.14 87.46 181 14 SER A 6 ? ? -171.72 88.51 182 14 LYS A 9 ? ? 50.29 83.86 183 14 ARG A 15 ? ? 35.38 -153.95 184 14 ASP A 22 ? ? 82.23 -14.32 185 14 LYS A 27 ? ? -128.53 -59.21 186 14 ASN A 28 ? ? -102.73 41.47 187 14 ARG A 30 ? ? -35.49 -34.97 188 14 PRO A 39 ? ? -69.73 1.93 189 14 ASN A 53 ? ? -95.34 50.39 190 14 LYS A 91 ? ? 61.96 128.75 191 14 TYR A 92 ? ? -179.77 149.80 192 14 ARG A 94 ? ? 61.68 71.30 193 14 LYS A 96 ? ? -177.55 103.03 194 14 PRO A 99 ? ? -69.81 2.56 195 14 SER A 100 ? ? 67.82 83.46 196 15 SER A 2 ? ? 72.22 42.84 197 15 SER A 5 ? ? 177.11 -56.30 198 15 ARG A 15 ? ? -41.80 164.29 199 15 ASN A 28 ? ? 179.26 30.26 200 15 ARG A 30 ? ? -38.98 -26.00 201 15 PRO A 39 ? ? -69.78 2.02 202 15 ASN A 45 ? ? -174.69 128.06 203 15 ASN A 50 ? ? -94.25 30.35 204 15 ASN A 53 ? ? -92.82 52.17 205 15 SER A 89 ? ? -72.50 -162.81 206 15 LYS A 91 ? ? 27.57 89.44 207 15 TYR A 92 ? ? -165.36 35.63 208 15 ARG A 94 ? ? -52.61 89.62 209 15 LYS A 96 ? ? -177.87 55.04 210 15 PRO A 99 ? ? -69.65 -179.82 211 15 SER A 100 ? ? -103.94 79.40 212 15 SER A 101 ? ? -90.58 -61.70 213 16 SER A 5 ? ? 65.96 144.92 214 16 GLN A 8 ? ? 78.36 -55.35 215 16 LYS A 9 ? ? 54.51 92.50 216 16 ARG A 15 ? ? 39.77 -161.74 217 16 ARG A 30 ? ? -35.94 -37.46 218 16 PRO A 39 ? ? -69.70 2.01 219 16 ASN A 45 ? ? -176.31 128.24 220 16 ASN A 53 ? ? -96.78 51.26 221 16 SER A 89 ? ? -61.83 -168.28 222 16 GLN A 90 ? ? -160.91 43.07 223 16 LYS A 91 ? ? -177.11 101.82 224 16 TYR A 92 ? ? 171.12 73.18 225 16 ILE A 95 ? ? 62.21 135.45 226 16 LYS A 96 ? ? 61.21 146.46 227 16 SER A 101 ? ? -109.91 40.72 228 17 SER A 2 ? ? -139.76 -42.32 229 17 SER A 3 ? ? 58.81 102.00 230 17 LYS A 9 ? ? -80.69 42.31 231 17 ARG A 15 ? ? 40.61 -163.40 232 17 ASP A 22 ? ? 75.45 -2.91 233 17 LYS A 27 ? ? 71.77 -70.72 234 17 ASN A 28 ? ? -88.44 31.35 235 17 ARG A 30 ? ? -39.37 -32.56 236 17 ASN A 45 ? ? -173.00 127.96 237 17 ASN A 53 ? ? -91.92 55.13 238 17 SER A 89 ? ? -56.29 -171.73 239 17 GLN A 90 ? ? -141.62 -43.68 240 17 TYR A 92 ? ? 170.10 -68.52 241 17 LYS A 93 ? ? -174.14 -71.60 242 17 ARG A 94 ? ? 172.00 -38.09 243 17 ILE A 95 ? ? 74.46 -69.45 244 17 LYS A 96 ? ? -51.20 103.43 245 17 SER A 97 ? ? 58.98 88.77 246 17 SER A 100 ? ? -152.39 -51.67 247 17 SER A 101 ? ? 51.70 177.65 248 18 SER A 2 ? ? 67.03 174.11 249 18 SER A 3 ? ? 57.03 -176.32 250 18 SER A 6 ? ? 39.00 81.01 251 18 ARG A 15 ? ? 42.15 -166.20 252 18 ARG A 30 ? ? -35.05 -34.73 253 18 PRO A 39 ? ? -69.75 1.94 254 18 ASN A 45 ? ? -177.90 128.10 255 18 ASN A 53 ? ? -103.86 51.97 256 18 GLN A 90 ? ? -156.96 57.52 257 18 ARG A 94 ? ? 64.74 81.40 258 18 LYS A 96 ? ? 174.56 -30.30 259 18 SER A 100 ? ? 80.86 103.65 260 19 SER A 6 ? ? 67.78 94.10 261 19 GLN A 8 ? ? 43.22 94.64 262 19 LYS A 9 ? ? 82.23 -60.28 263 19 ARG A 15 ? ? 41.17 -164.45 264 19 PRO A 39 ? ? -69.65 1.32 265 19 ASN A 45 ? ? -176.11 128.02 266 19 ASN A 50 ? ? -91.61 32.17 267 19 ASN A 53 ? ? -96.35 48.30 268 19 GLN A 90 ? ? -154.39 73.92 269 19 TYR A 92 ? ? 50.94 84.43 270 19 ARG A 94 ? ? -159.68 80.06 271 19 SER A 97 ? ? -116.97 -81.20 272 19 SER A 100 ? ? -34.48 130.27 273 20 SER A 2 ? ? -90.20 -69.45 274 20 SER A 3 ? ? -171.90 98.21 275 20 SER A 5 ? ? -87.47 40.23 276 20 GLU A 13 ? ? 48.02 86.69 277 20 ARG A 15 ? ? 35.87 -154.61 278 20 ASP A 22 ? ? 75.48 -5.66 279 20 ARG A 30 ? ? -34.65 -37.40 280 20 PRO A 39 ? ? -69.83 0.92 281 20 ASN A 45 ? ? -177.60 127.95 282 20 ASN A 50 ? ? -87.50 38.99 283 20 ASN A 53 ? ? -93.16 50.35 284 20 LEU A 88 ? ? -108.12 76.10 285 20 SER A 89 ? ? -69.45 -173.23 286 20 GLN A 90 ? ? -150.34 62.52 287 20 TYR A 92 ? ? 60.65 101.12 288 20 ARG A 94 ? ? 83.10 -36.81 289 20 ILE A 95 ? ? 73.05 -64.13 #