data_1X4T # _entry.id 1X4T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1X4T pdb_00001x4t 10.2210/pdb1x4t/pdb RCSB RCSB024379 ? ? WWPDB D_1000024379 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id mmt007014313.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1X4T _pdbx_database_status.recvd_initial_deposition_date 2005-05-14 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'He, F.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Shirouzu, M.' 5 'Terada, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of Isy1 domain in hypothetical protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'He, F.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Shirouzu, M.' 5 ? primary 'Terada, T.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'hypothetical protein LOC57905' _entity.formula_weight 10224.619 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Mus musculus adult male thymus cDNA, RIKEN full-length enriched library, clone:5830446M03 product:hypothetical protein, full insert sequence ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKLLREKGHWEVRIKELGG PDYGKVSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKLLREKGHWEVRIKELGG PDYGKVSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier mmt007014313.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LYS n 1 9 VAL n 1 10 LYS n 1 11 GLU n 1 12 ARG n 1 13 ARG n 1 14 PRO n 1 15 PHE n 1 16 LEU n 1 17 ALA n 1 18 SER n 1 19 GLU n 1 20 CYS n 1 21 THR n 1 22 GLU n 1 23 LEU n 1 24 PRO n 1 25 LYS n 1 26 ALA n 1 27 GLU n 1 28 LYS n 1 29 TRP n 1 30 ARG n 1 31 ARG n 1 32 GLN n 1 33 ILE n 1 34 ILE n 1 35 GLY n 1 36 GLU n 1 37 ILE n 1 38 SER n 1 39 LYS n 1 40 LYS n 1 41 VAL n 1 42 ALA n 1 43 GLN n 1 44 ILE n 1 45 GLN n 1 46 ASN n 1 47 ALA n 1 48 GLY n 1 49 LEU n 1 50 GLY n 1 51 GLU n 1 52 PHE n 1 53 ARG n 1 54 ILE n 1 55 ARG n 1 56 ASP n 1 57 LEU n 1 58 ASN n 1 59 ASP n 1 60 GLU n 1 61 ILE n 1 62 ASN n 1 63 LYS n 1 64 LEU n 1 65 LEU n 1 66 ARG n 1 67 GLU n 1 68 LYS n 1 69 GLY n 1 70 HIS n 1 71 TRP n 1 72 GLU n 1 73 VAL n 1 74 ARG n 1 75 ILE n 1 76 LYS n 1 77 GLU n 1 78 LEU n 1 79 GLY n 1 80 GLY n 1 81 PRO n 1 82 ASP n 1 83 TYR n 1 84 GLY n 1 85 LYS n 1 86 VAL n 1 87 SER n 1 88 GLY n 1 89 PRO n 1 90 SER n 1 91 SER n 1 92 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene 5830446M03Rik _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P041018-11 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9D3E2_MOUSE _struct_ref.pdbx_db_accession Q9D3E2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKLLREKGHWEVRIKELGGPDYGKV _struct_ref.pdbx_align_begin 24 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1X4T _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 86 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9D3E2 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 102 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 86 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1X4T GLY A 1 ? UNP Q9D3E2 ? ? 'cloning artifact' 1 1 1 1X4T SER A 2 ? UNP Q9D3E2 ? ? 'cloning artifact' 2 2 1 1X4T SER A 3 ? UNP Q9D3E2 ? ? 'cloning artifact' 3 3 1 1X4T GLY A 4 ? UNP Q9D3E2 ? ? 'cloning artifact' 4 4 1 1X4T SER A 5 ? UNP Q9D3E2 ? ? 'cloning artifact' 5 5 1 1X4T SER A 6 ? UNP Q9D3E2 ? ? 'cloning artifact' 6 6 1 1X4T GLY A 7 ? UNP Q9D3E2 ? ? 'cloning artifact' 7 7 1 1X4T SER A 87 ? UNP Q9D3E2 ? ? 'cloning artifact' 87 8 1 1X4T GLY A 88 ? UNP Q9D3E2 ? ? 'cloning artifact' 88 9 1 1X4T PRO A 89 ? UNP Q9D3E2 ? ? 'cloning artifact' 89 10 1 1X4T SER A 90 ? UNP Q9D3E2 ? ? 'cloning artifact' 90 11 1 1X4T SER A 91 ? UNP Q9D3E2 ? ? 'cloning artifact' 91 12 1 1X4T GLY A 92 ? UNP Q9D3E2 ? ? 'cloning artifact' 92 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8mM U-15, 13C; 20mM phosphate buffer NA; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O,10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1X4T _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1X4T _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1X4T _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20031121 Delaglio,F. 2 'data analysis' NMRView 5.0.4 Johnson,B.A. 3 'data analysis' KUJIRA 0.863 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 Guntert,P. 5 refinement CYANA 2.0.17 Guntert,P. 6 # _exptl.entry_id 1X4T _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1X4T _struct.title 'Solution structure of Isy1 domain in hypothetical protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1X4T _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text ;Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 17 ? CYS A 20 ? ALA A 17 CYS A 20 1 ? 4 HELX_P HELX_P2 2 LEU A 23 ? ASN A 46 ? LEU A 23 ASN A 46 1 ? 24 HELX_P HELX_P3 3 GLU A 51 ? LEU A 78 ? GLU A 51 LEU A 78 1 ? 28 HELX_P HELX_P4 4 TYR A 83 ? VAL A 86 ? TYR A 83 VAL A 86 1 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1X4T _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1X4T _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 TRP 71 71 71 TRP TRP A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 GLY 92 92 92 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-14 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX Determination method: author determined ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 14 ? ? -69.78 -165.10 2 1 PRO A 89 ? ? -69.79 -174.65 3 2 GLU A 11 ? ? -171.00 143.30 4 2 PRO A 14 ? ? -69.78 -163.65 5 3 SER A 3 ? ? -124.29 -52.16 6 3 LYS A 10 ? ? -53.39 172.68 7 3 PRO A 14 ? ? -69.82 -163.68 8 3 LYS A 39 ? ? -38.64 -31.87 9 3 ALA A 47 ? ? 35.47 52.72 10 3 TRP A 71 ? ? -64.96 -71.90 11 3 GLU A 72 ? ? -36.48 -35.64 12 3 LYS A 85 ? ? -39.03 -71.08 13 4 LYS A 10 ? ? -64.33 75.46 14 4 PRO A 14 ? ? -69.73 -163.73 15 4 THR A 21 ? ? 44.38 25.80 16 4 LYS A 39 ? ? -36.39 -33.83 17 5 SER A 2 ? ? -167.73 113.58 18 5 LYS A 10 ? ? -44.15 166.51 19 5 PRO A 14 ? ? -69.79 -163.60 20 5 LYS A 39 ? ? -37.69 -34.15 21 5 VAL A 86 ? ? -34.04 145.58 22 6 PRO A 14 ? ? -69.80 -163.68 23 6 ALA A 47 ? ? 37.74 48.95 24 6 LEU A 57 ? ? -91.82 -65.29 25 6 PRO A 89 ? ? -69.79 87.78 26 7 PRO A 14 ? ? -69.74 -164.47 27 7 ALA A 47 ? ? 38.98 52.09 28 8 PRO A 14 ? ? -69.73 -163.79 29 8 THR A 21 ? ? 46.45 29.27 30 8 ALA A 47 ? ? 36.28 50.34 31 9 SER A 5 ? ? -37.33 145.67 32 9 PRO A 14 ? ? -69.80 -163.74 33 9 ALA A 47 ? ? 37.42 47.13 34 9 ILE A 61 ? ? -37.04 -73.13 35 9 SER A 87 ? ? -173.43 118.64 36 9 PRO A 89 ? ? -69.75 95.64 37 10 SER A 5 ? ? -44.87 108.43 38 10 PRO A 14 ? ? -69.74 -163.79 39 10 ALA A 47 ? ? 71.77 44.21 40 10 SER A 90 ? ? -49.68 172.30 41 11 SER A 5 ? ? -171.09 134.91 42 11 PRO A 14 ? ? -69.71 -163.86 43 11 LYS A 39 ? ? -39.54 -37.52 44 11 SER A 91 ? ? -53.95 96.32 45 12 SER A 3 ? ? -52.75 109.07 46 12 SER A 6 ? ? -68.60 94.38 47 12 PRO A 14 ? ? -69.75 -163.67 48 12 GLU A 51 ? ? -34.38 -38.23 49 12 VAL A 86 ? ? -93.47 58.83 50 13 PRO A 14 ? ? -69.74 -163.82 51 13 VAL A 86 ? ? -81.45 46.14 52 13 SER A 87 ? ? -172.48 148.67 53 13 SER A 91 ? ? -36.56 119.75 54 14 SER A 2 ? ? -89.81 42.06 55 14 SER A 5 ? ? -55.70 107.82 56 14 SER A 6 ? ? 37.15 40.36 57 14 VAL A 9 ? ? -84.28 44.11 58 14 PRO A 14 ? ? -69.73 -163.81 59 14 PHE A 15 ? ? -131.33 -34.59 60 14 THR A 21 ? ? -89.10 35.00 61 14 PHE A 52 ? ? -34.77 -40.00 62 14 GLU A 72 ? ? -39.89 -30.01 63 14 PRO A 89 ? ? -69.77 86.78 64 14 SER A 91 ? ? -48.91 102.35 65 15 PRO A 14 ? ? -69.81 -163.68 66 15 ALA A 47 ? ? 36.16 52.09 67 15 VAL A 86 ? ? -42.11 103.54 68 16 LYS A 8 ? ? -58.91 109.90 69 16 PRO A 14 ? ? -69.75 -173.79 70 16 ALA A 47 ? ? 70.84 40.55 71 17 SER A 6 ? ? -57.26 176.61 72 17 PRO A 14 ? ? -69.72 -164.36 73 17 THR A 21 ? ? 42.14 28.91 74 17 SER A 87 ? ? -124.56 -57.13 75 18 SER A 5 ? ? -172.22 145.68 76 18 PRO A 14 ? ? -69.83 -163.62 77 18 TRP A 71 ? ? -66.69 -70.06 78 18 GLU A 72 ? ? -39.31 -29.10 79 18 PRO A 89 ? ? -69.74 2.65 80 18 SER A 91 ? ? -56.55 106.98 81 19 VAL A 9 ? ? -37.55 -39.72 82 19 PRO A 14 ? ? -69.76 -163.70 83 19 THR A 21 ? ? -81.54 39.29 84 19 LYS A 39 ? ? -38.51 -32.82 85 19 TRP A 71 ? ? -70.02 -71.23 86 19 GLU A 72 ? ? -35.47 -36.34 87 19 SER A 90 ? ? -83.39 47.59 88 20 PRO A 14 ? ? -69.81 -163.80 89 20 THR A 21 ? ? -87.23 41.51 90 20 ALA A 47 ? ? 34.26 47.78 #