data_1X5V # _entry.id 1X5V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1X5V pdb_00001x5v 10.2210/pdb1x5v/pdb RCSB RCSB024417 ? ? WWPDB D_1000024417 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1X5V _pdbx_database_status.recvd_initial_deposition_date 2005-05-17 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pimentel, C.' 1 'Choi, S.J.' 2 'Chagot, B.' 3 'Guette, C.' 4 'Camadro, J.M.' 5 'Darbon, H.' 6 # _citation.id primary _citation.title 'Solution structure of PcFK1, a spider peptide active against Plasmodium falciparum' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 15 _citation.page_first 628 _citation.page_last 634 _citation.year 2006 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16452619 _citation.pdbx_database_id_DOI 10.1110/ps.051860606 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pimentel, C.' 1 ? primary 'Choi, S.J.' 2 ? primary 'Chagot, B.' 3 ? primary 'Guette, C.' 4 ? primary 'Camadro, J.M.' 5 ? primary 'Darbon, H.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description PcFK1 _entity.formula_weight 3712.397 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'ACGILHDNCVYVPAQNPCCRGLQCRYGKCLVQV(HSL)' _entity_poly.pdbx_seq_one_letter_code_can ACGILHDNCVYVPAQNPCCRGLQCRYGKCLVQVS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 CYS n 1 3 GLY n 1 4 ILE n 1 5 LEU n 1 6 HIS n 1 7 ASP n 1 8 ASN n 1 9 CYS n 1 10 VAL n 1 11 TYR n 1 12 VAL n 1 13 PRO n 1 14 ALA n 1 15 GLN n 1 16 ASN n 1 17 PRO n 1 18 CYS n 1 19 CYS n 1 20 ARG n 1 21 GLY n 1 22 LEU n 1 23 GLN n 1 24 CYS n 1 25 ARG n 1 26 TYR n 1 27 GLY n 1 28 LYS n 1 29 CYS n 1 30 LEU n 1 31 VAL n 1 32 GLN n 1 33 VAL n 1 34 HSL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Trinidad chevron tarantula' _entity_src_gen.gene_src_genus Psalmopoeus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Psalmopoeus cambridgei' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 179874 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code TXFK1_PSACA _struct_ref.pdbx_db_accession P0C201 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1X5V _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 33 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0C201 _struct_ref_seq.db_align_beg 52 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 84 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 33 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HSL 'L-peptide linking' n 'HOMOSERINE LACTONE' ? 'C4 H7 N O2' 101.104 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 DQF-COSY 1 2 1 '2D TOCSY' 1 3 2 '2D NOESY' 1 4 2 DQF-COSY 1 5 2 '2D TOCSY' 1 6 2 '2D NOESY' 1 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 290 1 3 ? atm K 2 300 1 3 ? atm K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents 1mM _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1X5V _pdbx_nmr_refine.method 'molecular dynamics based simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1X5V _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal processing XwinNMR 2.1 'Bruker biospin' 1 'structure solution' ARIA 1.2 'Jens Linge' 2 refinement ARIA 1.2 'Jens Linge' 3 # _exptl.entry_id 1X5V _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1X5V _struct.title 'NMR Structure of PcFK1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1X5V _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'Inhibitory Cystine Knot, toxin' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id VAL _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 12 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 16 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id VAL _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 12 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 16 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 2 SG ? ? ? 1_555 A CYS 19 SG ? ? A CYS 2 A CYS 19 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf2 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 24 SG ? ? A CYS 9 A CYS 24 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf3 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 18 A CYS 29 1_555 ? ? ? ? ? ? ? 2.029 ? ? covale1 covale both ? A VAL 33 C ? ? ? 1_555 A HSL 34 N ? ? A VAL 33 A HSL 34 1_555 ? ? ? ? ? ? ? 1.321 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASN A 8 ? CYS A 9 ? ASN A 8 CYS A 9 A 2 GLY A 27 ? VAL A 31 ? GLY A 27 VAL A 31 A 3 LEU A 22 ? ARG A 25 ? LEU A 22 ARG A 25 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N CYS A 9 ? N CYS A 9 O GLY A 27 ? O GLY A 27 A 2 3 O LEU A 30 ? O LEU A 30 N GLN A 23 ? N GLN A 23 # _database_PDB_matrix.entry_id 1X5V _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1X5V _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 HSL 34 34 34 HSL HSL A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id HSL _pdbx_struct_mod_residue.label_seq_id 34 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id HSL _pdbx_struct_mod_residue.auth_seq_id 34 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details 'HOMOSERINE LACTONE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-04-04 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 19 _pdbx_validate_close_contact.auth_atom_id_1 HE21 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLN _pdbx_validate_close_contact.auth_seq_id_1 32 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HSL _pdbx_validate_close_contact.auth_seq_id_2 34 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.40 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 6 ? ? -147.86 41.16 2 1 ARG A 20 ? ? -54.04 108.42 3 1 TYR A 26 ? ? -55.60 90.24 4 2 LEU A 5 ? ? -69.13 14.10 5 2 HIS A 6 ? ? -160.37 39.90 6 2 TYR A 26 ? ? -56.76 89.03 7 3 TYR A 11 ? ? -65.21 86.37 8 3 GLN A 15 ? ? -108.85 42.24 9 3 TYR A 26 ? ? -49.45 92.62 10 4 LEU A 5 ? ? -55.94 -9.64 11 4 HIS A 6 ? ? -147.16 34.47 12 4 TYR A 26 ? ? -44.97 95.05 13 5 LEU A 5 ? ? -67.86 6.24 14 5 HIS A 6 ? ? -161.01 45.86 15 5 CYS A 9 ? ? -170.58 145.05 16 5 TYR A 26 ? ? -68.22 78.46 17 6 LEU A 5 ? ? -68.47 18.92 18 6 HIS A 6 ? ? -161.58 41.91 19 6 CYS A 9 ? ? 177.18 124.62 20 6 VAL A 10 ? ? -79.57 -159.12 21 6 TYR A 26 ? ? -45.62 93.88 22 7 HIS A 6 ? ? -160.26 43.32 23 7 ARG A 20 ? ? -57.16 109.99 24 7 TYR A 26 ? ? -50.32 97.41 25 8 LEU A 5 ? ? -64.89 3.62 26 8 HIS A 6 ? ? -152.56 36.10 27 8 ARG A 20 ? ? -55.97 107.70 28 8 TYR A 26 ? ? -50.10 99.43 29 9 LEU A 5 ? ? -57.09 -6.93 30 9 HIS A 6 ? ? -147.89 51.96 31 9 GLN A 15 ? ? -141.73 57.52 32 9 TYR A 26 ? ? -37.88 91.97 33 10 LEU A 5 ? ? -57.12 -7.62 34 10 HIS A 6 ? ? -158.45 48.50 35 10 ARG A 20 ? ? -59.87 103.24 36 10 TYR A 26 ? ? -52.51 96.29 37 11 LEU A 5 ? ? -66.77 12.13 38 11 HIS A 6 ? ? -154.88 42.16 39 11 TYR A 26 ? ? -49.60 94.30 40 12 LEU A 5 ? ? -37.05 -38.38 41 12 HIS A 6 ? ? -141.94 29.72 42 12 TYR A 11 ? ? -69.61 82.46 43 12 TYR A 26 ? ? -58.95 85.83 44 13 HIS A 6 ? ? -145.07 38.60 45 13 TYR A 11 ? ? -66.34 80.84 46 13 CYS A 24 ? ? -68.10 99.63 47 13 TYR A 26 ? ? -51.10 101.60 48 14 LEU A 5 ? ? -57.44 -6.62 49 14 HIS A 6 ? ? -154.88 43.36 50 14 TYR A 26 ? ? -47.62 91.45 51 15 LEU A 5 ? ? -56.42 -4.60 52 15 HIS A 6 ? ? -151.15 37.75 53 15 TYR A 11 ? ? -68.39 76.68 54 15 ASN A 16 ? ? -49.95 104.66 55 15 TYR A 26 ? ? -52.03 82.49 56 16 LEU A 5 ? ? -67.93 2.85 57 16 HIS A 6 ? ? -150.25 45.57 58 16 TYR A 26 ? ? -50.58 95.63 59 16 GLN A 32 ? ? -68.71 80.82 60 17 LEU A 5 ? ? -65.19 12.43 61 17 HIS A 6 ? ? -157.44 41.16 62 17 TYR A 26 ? ? -61.25 85.93 63 18 HIS A 6 ? ? -142.66 37.75 64 18 TYR A 11 ? ? -69.11 75.64 65 18 PRO A 17 ? ? -83.36 48.71 66 18 TYR A 26 ? ? -53.10 93.45 67 19 HIS A 6 ? ? -151.10 47.09 68 19 TYR A 11 ? ? -67.81 86.94 69 19 TYR A 26 ? ? -55.79 97.11 70 20 LEU A 5 ? ? -59.07 -6.90 71 20 HIS A 6 ? ? -150.10 49.06 72 20 TYR A 26 ? ? -50.25 100.85 73 20 GLN A 32 ? ? -69.83 93.71 74 21 HIS A 6 ? ? -160.48 31.61 75 21 TYR A 11 ? ? -62.02 80.54 76 21 ARG A 20 ? ? -56.86 108.61 77 21 TYR A 26 ? ? -46.80 96.35 78 22 LEU A 5 ? ? -59.54 -4.42 79 22 HIS A 6 ? ? -144.91 50.00 80 22 ARG A 20 ? ? -48.13 108.26 81 22 TYR A 26 ? ? -58.44 81.05 82 23 HIS A 6 ? ? -150.54 48.66 83 23 CYS A 9 ? ? -175.35 146.10 84 23 ARG A 20 ? ? -61.21 99.98 85 23 TYR A 26 ? ? -52.22 92.92 86 24 LEU A 5 ? ? -58.31 -1.34 87 24 HIS A 6 ? ? -156.30 50.27 88 24 TYR A 26 ? ? -55.00 90.64 89 25 HIS A 6 ? ? -140.85 46.42 90 25 GLN A 15 ? ? -141.45 59.32 91 25 TYR A 26 ? ? -57.24 91.01 #