data_1X63 # _entry.id 1X63 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1X63 pdb_00001x63 10.2210/pdb1x63/pdb RCSB RCSB024425 ? ? WWPDB D_1000024425 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001003796.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1X63 _pdbx_database_status.recvd_initial_deposition_date 2005-05-17 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, X.R.' 1 'Nagashima, T.' 2 'Hayashi, F.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'Solution structure of the second LIM domain of skeletal muscle LIM protein 1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, X.R.' 1 ? primary 'Nagashima, T.' 2 ? primary 'Hayashi, F.' 3 ? primary 'Yokoyama, S.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Skeletal muscle LIM-protein 1' 8728.756 1 ? ? 'LIM domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SLIM 1, SLIM, Four and a half LIM domains protein 1, FHL-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGKCTTREDSPKCKGCFKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFASGPS SG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGKCTTREDSPKCKGCFKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFASGPS SG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001003796.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LYS n 1 9 CYS n 1 10 THR n 1 11 THR n 1 12 ARG n 1 13 GLU n 1 14 ASP n 1 15 SER n 1 16 PRO n 1 17 LYS n 1 18 CYS n 1 19 LYS n 1 20 GLY n 1 21 CYS n 1 22 PHE n 1 23 LYS n 1 24 ALA n 1 25 ILE n 1 26 VAL n 1 27 ALA n 1 28 GLY n 1 29 ASP n 1 30 GLN n 1 31 ASN n 1 32 VAL n 1 33 GLU n 1 34 TYR n 1 35 LYS n 1 36 GLY n 1 37 THR n 1 38 VAL n 1 39 TRP n 1 40 HIS n 1 41 LYS n 1 42 ASP n 1 43 CYS n 1 44 PHE n 1 45 THR n 1 46 CYS n 1 47 SER n 1 48 ASN n 1 49 CYS n 1 50 LYS n 1 51 GLN n 1 52 VAL n 1 53 ILE n 1 54 GLY n 1 55 THR n 1 56 GLY n 1 57 SER n 1 58 PHE n 1 59 PHE n 1 60 PRO n 1 61 LYS n 1 62 GLY n 1 63 GLU n 1 64 ASP n 1 65 PHE n 1 66 TYR n 1 67 CYS n 1 68 VAL n 1 69 THR n 1 70 CYS n 1 71 HIS n 1 72 GLU n 1 73 THR n 1 74 LYS n 1 75 PHE n 1 76 ALA n 1 77 SER n 1 78 GLY n 1 79 PRO n 1 80 SER n 1 81 SER n 1 82 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'FHL1, SLIM1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P040816-09 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FHL1_HUMAN _struct_ref.pdbx_db_accession Q13642 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KCTTREDSPKCKGCFKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFA _struct_ref.pdbx_align_begin 90 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1X63 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 76 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13642 _struct_ref_seq.db_align_beg 90 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 158 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 76 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1X63 GLY A 1 ? UNP Q13642 ? ? 'cloning artifact' 1 1 1 1X63 SER A 2 ? UNP Q13642 ? ? 'cloning artifact' 2 2 1 1X63 SER A 3 ? UNP Q13642 ? ? 'cloning artifact' 3 3 1 1X63 GLY A 4 ? UNP Q13642 ? ? 'cloning artifact' 4 4 1 1X63 SER A 5 ? UNP Q13642 ? ? 'cloning artifact' 5 5 1 1X63 SER A 6 ? UNP Q13642 ? ? 'cloning artifact' 6 6 1 1X63 GLY A 7 ? UNP Q13642 ? ? 'cloning artifact' 7 7 1 1X63 SER A 77 ? UNP Q13642 ? ? 'cloning artifact' 77 8 1 1X63 GLY A 78 ? UNP Q13642 ? ? 'cloning artifact' 78 9 1 1X63 PRO A 79 ? UNP Q13642 ? ? 'cloning artifact' 79 10 1 1X63 SER A 80 ? UNP Q13642 ? ? 'cloning artifact' 80 11 1 1X63 SER A 81 ? UNP Q13642 ? ? 'cloning artifact' 81 12 1 1X63 GLY A 82 ? UNP Q13642 ? ? 'cloning artifact' 82 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.24mM 13C,15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3, 0.01mM ZnCl2' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1X63 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1X63 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the lowest energy, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1X63 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 Delaglio,F. 2 'data analysis' NMRView 5.0.4 Johnson,B.A. 3 'data analysis' KUJIRA 0.9296 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 Guntert,P. 5 refinement CYANA 2.0.17 Guntert,P. 6 # _exptl.entry_id 1X63 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1X63 _struct.title 'Solution structure of the second LIM domain of skeletal muscle LIM protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1X63 _struct_keywords.pdbx_keywords 'CONTRACTILE PROTEIN' _struct_keywords.text ;LIM domain, Skeletal muscle LIM-protein 1, Four and a half LIM domains protein 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Contractile protein ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id VAL _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 68 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id PHE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 75 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id VAL _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 68 _struct_conf.end_auth_comp_id PHE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 75 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 201 1_555 ? ? ? ? ? ? ? 2.360 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.345 ? ? metalc3 metalc ? ? A HIS 40 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 40 A ZN 201 1_555 ? ? ? ? ? ? ? 2.054 ? ? metalc4 metalc ? ? A CYS 43 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 43 A ZN 201 1_555 ? ? ? ? ? ? ? 2.264 ? ? metalc5 metalc ? ? A CYS 46 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 46 A ZN 401 1_555 ? ? ? ? ? ? ? 2.356 ? ? metalc6 metalc ? ? A CYS 49 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 49 A ZN 401 1_555 ? ? ? ? ? ? ? 2.325 ? ? metalc7 metalc ? ? A CYS 67 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 67 A ZN 401 1_555 ? ? ? ? ? ? ? 2.258 ? ? metalc8 metalc ? ? A CYS 70 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 70 A ZN 401 1_555 ? ? ? ? ? ? ? 2.307 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASN A 31 ? GLU A 33 ? ASN A 31 GLU A 33 A 2 VAL A 38 ? HIS A 40 ? VAL A 38 HIS A 40 B 1 PHE A 58 ? LYS A 61 ? PHE A 58 LYS A 61 B 2 ASP A 64 ? CYS A 67 ? ASP A 64 CYS A 67 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 32 ? N VAL A 32 O TRP A 39 ? O TRP A 39 B 1 2 N PHE A 59 ? N PHE A 59 O TYR A 66 ? O TYR A 66 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 4 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 2 AC1 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 3 AC1 4 HIS A 40 ? HIS A 40 . ? 1_555 ? 4 AC1 4 CYS A 43 ? CYS A 43 . ? 1_555 ? 5 AC2 4 CYS A 46 ? CYS A 46 . ? 1_555 ? 6 AC2 4 CYS A 49 ? CYS A 49 . ? 1_555 ? 7 AC2 4 CYS A 67 ? CYS A 67 . ? 1_555 ? 8 AC2 4 CYS A 70 ? CYS A 70 . ? 1_555 ? # _database_PDB_matrix.entry_id 1X63 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1X63 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 GLY 82 82 82 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 109.4 ? 2 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 40 ? A HIS 40 ? 1_555 104.5 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 40 ? A HIS 40 ? 1_555 105.2 ? 4 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 43 ? A CYS 43 ? 1_555 112.7 ? 5 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 43 ? A CYS 43 ? 1_555 108.4 ? 6 ND1 ? A HIS 40 ? A HIS 40 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 43 ? A CYS 43 ? 1_555 116.2 ? 7 SG ? A CYS 46 ? A CYS 46 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 49 ? A CYS 49 ? 1_555 102.1 ? 8 SG ? A CYS 46 ? A CYS 46 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 67 ? A CYS 67 ? 1_555 113.1 ? 9 SG ? A CYS 49 ? A CYS 49 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 67 ? A CYS 67 ? 1_555 112.6 ? 10 SG ? A CYS 46 ? A CYS 46 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 70 ? A CYS 70 ? 1_555 110.7 ? 11 SG ? A CYS 49 ? A CYS 49 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 70 ? A CYS 70 ? 1_555 112.4 ? 12 SG ? A CYS 67 ? A CYS 67 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 70 ? A CYS 70 ? 1_555 106.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-17 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 5 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 6 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 16 4 'Structure model' '_struct_ref_seq_dif.details' 17 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 18 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 19 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -102.63 41.60 2 1 CYS A 9 ? ? -46.45 169.50 3 1 SER A 15 ? ? -170.71 142.49 4 1 THR A 37 ? ? -46.02 159.45 5 1 PHE A 44 ? ? -55.07 104.28 6 1 THR A 55 ? ? -38.93 -38.02 7 1 PHE A 75 ? ? -92.96 -73.34 8 1 ALA A 76 ? ? -45.28 155.22 9 2 PHE A 22 ? ? 70.55 33.12 10 2 ASN A 48 ? ? -95.70 -64.57 11 2 VAL A 52 ? ? -42.84 109.01 12 2 GLU A 63 ? ? -84.61 45.07 13 2 PHE A 75 ? ? -93.09 -67.63 14 2 ALA A 76 ? ? -56.65 177.86 15 3 SER A 2 ? ? -160.59 108.07 16 3 THR A 37 ? ? -44.16 159.51 17 3 PHE A 44 ? ? -57.05 108.66 18 3 VAL A 52 ? ? -38.54 116.41 19 3 PHE A 75 ? ? -94.50 -73.36 20 3 ALA A 76 ? ? -51.21 172.30 21 4 SER A 2 ? ? -80.54 44.64 22 4 PHE A 22 ? ? 70.33 35.47 23 4 LYS A 41 ? ? -38.36 -29.37 24 4 VAL A 68 ? ? -40.03 -73.38 25 4 PHE A 75 ? ? -87.98 -71.53 26 4 ALA A 76 ? ? -56.03 171.94 27 5 SER A 3 ? ? -128.97 -54.29 28 5 LYS A 41 ? ? -38.78 -26.25 29 5 THR A 55 ? ? -38.01 -38.60 30 5 GLU A 63 ? ? -82.38 43.06 31 5 ALA A 76 ? ? -55.68 170.33 32 5 SER A 77 ? ? -38.88 138.81 33 5 PRO A 79 ? ? -69.72 2.97 34 5 SER A 80 ? ? -34.07 116.23 35 6 PHE A 22 ? ? 70.69 33.04 36 6 ASN A 48 ? ? -92.06 -66.96 37 6 VAL A 68 ? ? -41.19 -73.04 38 6 PHE A 75 ? ? -86.27 -73.28 39 7 LYS A 8 ? ? -68.96 95.11 40 7 THR A 11 ? ? -66.99 90.77 41 7 PHE A 22 ? ? 70.13 34.38 42 7 THR A 37 ? ? -43.51 159.72 43 7 PHE A 44 ? ? -52.71 104.64 44 7 VAL A 52 ? ? -38.58 115.74 45 7 VAL A 68 ? ? -38.80 -71.54 46 7 PHE A 75 ? ? -92.00 -74.05 47 7 ALA A 76 ? ? -53.74 -179.23 48 7 PRO A 79 ? ? -69.77 -173.87 49 8 SER A 6 ? ? -171.49 131.56 50 8 THR A 10 ? ? -162.37 117.99 51 8 PHE A 44 ? ? -54.82 104.20 52 8 ASN A 48 ? ? -93.96 -70.34 53 8 PRO A 60 ? ? -69.79 99.37 54 8 PHE A 75 ? ? -96.46 -75.96 55 8 ALA A 76 ? ? -49.57 170.05 56 8 SER A 77 ? ? -63.07 98.85 57 8 PRO A 79 ? ? -69.68 -175.56 58 9 SER A 2 ? ? -174.00 115.13 59 9 ASP A 14 ? ? -84.36 45.70 60 9 PHE A 22 ? ? 70.23 33.06 61 9 PHE A 44 ? ? -59.30 100.73 62 9 ASN A 48 ? ? -94.73 -63.50 63 9 THR A 55 ? ? -37.02 -35.79 64 9 PHE A 75 ? ? -92.72 -75.03 65 9 ALA A 76 ? ? -52.27 175.49 66 10 ARG A 12 ? ? -93.53 41.75 67 10 LYS A 41 ? ? -38.82 -26.59 68 10 PHE A 44 ? ? -55.24 109.33 69 10 ASN A 48 ? ? -92.80 -66.11 70 10 VAL A 52 ? ? -38.80 105.26 71 10 VAL A 68 ? ? -34.33 -71.30 72 10 PHE A 75 ? ? -83.07 -70.19 73 10 PRO A 79 ? ? -69.74 86.92 74 11 ASP A 14 ? ? -81.11 41.95 75 11 THR A 37 ? ? -51.88 172.15 76 11 ASN A 48 ? ? -92.39 -69.48 77 11 VAL A 52 ? ? -38.31 115.98 78 11 PHE A 75 ? ? -83.53 -74.92 79 11 ALA A 76 ? ? -51.96 178.45 80 12 THR A 37 ? ? -47.84 160.40 81 12 ASN A 48 ? ? -95.56 -69.19 82 12 VAL A 68 ? ? -37.35 -72.07 83 12 PHE A 75 ? ? -91.04 -70.53 84 12 ALA A 76 ? ? -55.89 173.73 85 12 PRO A 79 ? ? -69.82 91.24 86 12 SER A 81 ? ? -165.72 117.65 87 13 THR A 10 ? ? -90.34 38.59 88 13 THR A 37 ? ? -47.87 169.04 89 13 ASN A 48 ? ? -94.06 -67.01 90 13 LYS A 74 ? ? -91.83 -64.55 91 13 PRO A 79 ? ? -69.71 0.44 92 14 ARG A 12 ? ? -89.81 41.81 93 14 ASP A 14 ? ? -104.40 40.12 94 14 LYS A 35 ? ? 38.65 39.22 95 14 THR A 37 ? ? -49.39 175.33 96 14 LYS A 41 ? ? -37.83 -27.27 97 14 PHE A 44 ? ? -54.11 105.68 98 14 ASN A 48 ? ? -90.02 -64.63 99 14 PHE A 75 ? ? -91.55 -68.32 100 14 ALA A 76 ? ? -54.73 172.33 101 15 ASP A 14 ? ? -80.32 44.50 102 15 THR A 37 ? ? -44.80 159.16 103 15 VAL A 52 ? ? -36.14 117.29 104 15 GLU A 63 ? ? -81.01 43.83 105 15 VAL A 68 ? ? -39.43 -71.64 106 15 PHE A 75 ? ? -93.34 -69.72 107 15 ALA A 76 ? ? -56.27 177.96 108 15 PRO A 79 ? ? -69.73 93.71 109 16 SER A 5 ? ? -87.97 41.64 110 16 PRO A 16 ? ? -69.76 99.60 111 16 LYS A 50 ? ? 35.37 46.63 112 16 VAL A 52 ? ? -46.15 107.28 113 16 PHE A 75 ? ? -92.24 -71.04 114 16 ALA A 76 ? ? -54.39 173.30 115 16 SER A 81 ? ? -68.98 97.48 116 17 THR A 10 ? ? -172.42 135.31 117 17 PHE A 44 ? ? -54.50 103.94 118 17 ASN A 48 ? ? -92.04 -67.52 119 17 GLU A 63 ? ? -83.90 44.39 120 17 PHE A 75 ? ? -100.59 -71.83 121 18 THR A 11 ? ? -46.71 160.68 122 18 ARG A 12 ? ? -44.84 161.79 123 18 GLU A 13 ? ? -170.93 130.62 124 18 ASP A 14 ? ? -102.39 42.57 125 18 PRO A 16 ? ? -69.72 99.73 126 18 PHE A 22 ? ? 71.12 33.68 127 18 ASN A 48 ? ? -92.76 -70.55 128 18 PHE A 75 ? ? -90.57 -73.86 129 18 ALA A 76 ? ? -51.38 179.70 130 19 ARG A 12 ? ? -68.98 95.51 131 19 THR A 37 ? ? -48.07 167.56 132 19 ASN A 48 ? ? -92.01 -62.45 133 19 VAL A 68 ? ? -38.54 -70.27 134 19 PHE A 75 ? ? -105.04 -71.55 135 19 ALA A 76 ? ? -48.49 172.77 136 19 SER A 77 ? ? 35.17 39.81 137 20 LYS A 8 ? ? -174.38 120.39 138 20 ASP A 14 ? ? -172.73 132.78 139 20 SER A 15 ? ? -170.24 139.64 140 20 THR A 37 ? ? -52.70 172.14 141 20 ASN A 48 ? ? -96.50 -60.11 142 20 PRO A 60 ? ? -69.73 97.31 143 20 ALA A 76 ? ? -79.48 48.97 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #