data_1X6F # _entry.id 1X6F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1X6F pdb_00001x6f 10.2210/pdb1x6f/pdb RCSB RCSB024437 ? ? WWPDB D_1000024437 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk002101771.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1X6F _pdbx_database_status.recvd_initial_deposition_date 2005-05-17 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sato, M.' 1 'Saito, K.' 2 'Koshiba, S.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Yokoyama, S.' 6 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 # _citation.id primary _citation.title 'Solution structures of the C2H2 type zinc finger domain of human Zinc finger protein 462' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sato, M.' 1 ? primary 'Saito, K.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Yokoyama, S.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger protein 462' 9845.938 1 ? ? 'C2H2 type zinc finger domain' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGLKRDFIILGNGPRLQNSTYQCKHCDSKLQSTAELTSHLNIHNEEFQKRAKRQERRKQLLSKQKYADGAFADFK QESGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGLKRDFIILGNGPRLQNSTYQCKHCDSKLQSTAELTSHLNIHNEEFQKRAKRQERRKQLLSKQKYADGAFADFK QESGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk002101771.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LEU n 1 9 LYS n 1 10 ARG n 1 11 ASP n 1 12 PHE n 1 13 ILE n 1 14 ILE n 1 15 LEU n 1 16 GLY n 1 17 ASN n 1 18 GLY n 1 19 PRO n 1 20 ARG n 1 21 LEU n 1 22 GLN n 1 23 ASN n 1 24 SER n 1 25 THR n 1 26 TYR n 1 27 GLN n 1 28 CYS n 1 29 LYS n 1 30 HIS n 1 31 CYS n 1 32 ASP n 1 33 SER n 1 34 LYS n 1 35 LEU n 1 36 GLN n 1 37 SER n 1 38 THR n 1 39 ALA n 1 40 GLU n 1 41 LEU n 1 42 THR n 1 43 SER n 1 44 HIS n 1 45 LEU n 1 46 ASN n 1 47 ILE n 1 48 HIS n 1 49 ASN n 1 50 GLU n 1 51 GLU n 1 52 PHE n 1 53 GLN n 1 54 LYS n 1 55 ARG n 1 56 ALA n 1 57 LYS n 1 58 ARG n 1 59 GLN n 1 60 GLU n 1 61 ARG n 1 62 ARG n 1 63 LYS n 1 64 GLN n 1 65 LEU n 1 66 LEU n 1 67 SER n 1 68 LYS n 1 69 GLN n 1 70 LYS n 1 71 TYR n 1 72 ALA n 1 73 ASP n 1 74 GLY n 1 75 ALA n 1 76 PHE n 1 77 ALA n 1 78 ASP n 1 79 PHE n 1 80 LYS n 1 81 GLN n 1 82 GLU n 1 83 SER n 1 84 GLY n 1 85 PRO n 1 86 SER n 1 87 SER n 1 88 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ZNF462 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P041012-05 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZN462_HUMAN _struct_ref.pdbx_db_accession Q96JM2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LKRDFIILGNGPRLQNSTYQCKHCDSKLQSTAELTSHLNIHNEEFQKRAKRQERRKQLLSKQKYADGAFADFKQE _struct_ref.pdbx_align_begin 719 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1X6F _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 82 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q96JM2 _struct_ref_seq.db_align_beg 719 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 793 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 82 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1X6F GLY A 1 ? UNP Q96JM2 ? ? 'cloning artifact' 1 1 1 1X6F SER A 2 ? UNP Q96JM2 ? ? 'cloning artifact' 2 2 1 1X6F SER A 3 ? UNP Q96JM2 ? ? 'cloning artifact' 3 3 1 1X6F GLY A 4 ? UNP Q96JM2 ? ? 'cloning artifact' 4 4 1 1X6F SER A 5 ? UNP Q96JM2 ? ? 'cloning artifact' 5 5 1 1X6F SER A 6 ? UNP Q96JM2 ? ? 'cloning artifact' 6 6 1 1X6F GLY A 7 ? UNP Q96JM2 ? ? 'cloning artifact' 7 7 1 1X6F SER A 83 ? UNP Q96JM2 ? ? 'cloning artifact' 83 8 1 1X6F GLY A 84 ? UNP Q96JM2 ? ? 'cloning artifact' 84 9 1 1X6F PRO A 85 ? UNP Q96JM2 ? ? 'cloning artifact' 85 10 1 1X6F SER A 86 ? UNP Q96JM2 ? ? 'cloning artifact' 86 11 1 1X6F SER A 87 ? UNP Q96JM2 ? ? 'cloning artifact' 87 12 1 1X6F GLY A 88 ? UNP Q96JM2 ? ? 'cloning artifact' 88 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM C2H2 type zinc finger domain U-15N, 13C; 20mM d-Tris HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 50uM ZnCl2; 0.1mM NTA; 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1X6F _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1X6F _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function, structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1X6F _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9295 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 1X6F _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1X6F _struct.title 'Solution structures of the C2H2 type zinc finger domain of human Zinc finger protein 462' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1X6F _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text ;zinc finger domain, KIAA1803, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 37 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 56 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 37 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 56 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 28 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 28 A ZN 201 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc2 metalc ? ? A CYS 31 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 31 A ZN 201 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc3 metalc ? ? A HIS 44 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 44 A ZN 201 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc4 metalc ? ? A HIS 48 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 48 A ZN 201 1_555 ? ? ? ? ? ? ? 2.329 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 26 ? GLN A 27 ? TYR A 26 GLN A 27 A 2 LYS A 34 ? LEU A 35 ? LYS A 34 LEU A 35 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 26 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 26 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LEU _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 35 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 35 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 28 ? CYS A 28 . ? 1_555 ? 2 AC1 4 CYS A 31 ? CYS A 31 . ? 1_555 ? 3 AC1 4 HIS A 44 ? HIS A 44 . ? 1_555 ? 4 AC1 4 HIS A 48 ? HIS A 48 . ? 1_555 ? # _database_PDB_matrix.entry_id 1X6F _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1X6F _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 GLY 88 88 88 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 31 ? A CYS 31 ? 1_555 117.5 ? 2 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 44 ? A HIS 44 ? 1_555 115.9 ? 3 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 44 ? A HIS 44 ? 1_555 86.8 ? 4 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 48 ? A HIS 48 ? 1_555 110.7 ? 5 SG ? A CYS 31 ? A CYS 31 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 48 ? A HIS 48 ? 1_555 114.3 ? 6 NE2 ? A HIS 44 ? A HIS 44 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 48 ? A HIS 48 ? 1_555 109.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-17 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 4 'Structure model' '_struct_ref_seq_dif.details' 18 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 19 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 20 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 9 ? ? -174.52 114.72 2 1 LEU A 15 ? ? -171.60 139.19 3 1 ASN A 17 ? ? -101.08 -67.47 4 1 PRO A 19 ? ? -69.76 2.39 5 1 ARG A 20 ? ? -46.83 174.12 6 1 SER A 24 ? ? 38.52 43.71 7 1 HIS A 30 ? ? -130.04 -39.29 8 1 ALA A 39 ? ? -34.80 -38.67 9 1 ALA A 56 ? ? -61.89 79.78 10 1 ARG A 58 ? ? -79.02 45.39 11 1 GLN A 59 ? ? -45.74 169.09 12 1 GLU A 60 ? ? -107.93 -60.64 13 1 ALA A 77 ? ? -40.30 100.87 14 1 SER A 83 ? ? -34.60 123.02 15 1 SER A 86 ? ? -69.09 88.52 16 2 SER A 3 ? ? -171.33 145.19 17 2 LEU A 8 ? ? -174.59 142.15 18 2 SER A 24 ? ? -84.45 43.78 19 2 ALA A 39 ? ? -36.04 -38.79 20 2 LYS A 57 ? ? -35.56 135.49 21 2 GLU A 60 ? ? -109.40 69.74 22 2 GLN A 64 ? ? -58.99 175.47 23 2 LYS A 68 ? ? -173.27 139.41 24 3 ILE A 14 ? ? 37.54 54.84 25 3 ALA A 39 ? ? -37.50 -38.21 26 3 LYS A 57 ? ? -102.62 41.29 27 3 LYS A 63 ? ? -59.11 170.21 28 3 SER A 67 ? ? -35.64 146.27 29 3 GLN A 69 ? ? -170.24 139.03 30 3 TYR A 71 ? ? -122.67 -61.52 31 3 GLN A 81 ? ? -173.86 -179.61 32 4 SER A 2 ? ? -171.71 145.32 33 4 PHE A 12 ? ? -174.42 110.87 34 4 LEU A 21 ? ? -35.68 101.96 35 4 GLN A 22 ? ? -101.19 -60.21 36 4 ASP A 32 ? ? 71.93 37.62 37 4 ALA A 39 ? ? -36.21 -31.63 38 4 ALA A 56 ? ? -82.97 36.03 39 4 ARG A 62 ? ? -84.38 32.61 40 4 LYS A 63 ? ? -39.90 155.51 41 4 ASP A 73 ? ? -107.02 -62.70 42 4 GLN A 81 ? ? -175.19 132.54 43 4 PRO A 85 ? ? -69.78 -176.94 44 4 SER A 87 ? ? -95.52 -61.40 45 5 ASP A 11 ? ? -163.27 105.53 46 5 ASN A 17 ? ? -38.52 152.45 47 5 PRO A 19 ? ? -69.70 81.52 48 5 ALA A 39 ? ? -36.11 -37.78 49 5 HIS A 48 ? ? -76.41 -72.35 50 5 LYS A 57 ? ? -35.35 116.36 51 5 ARG A 58 ? ? -34.39 130.33 52 5 ARG A 61 ? ? -48.95 155.75 53 5 GLU A 82 ? ? 39.21 43.86 54 5 PRO A 85 ? ? -69.76 -179.67 55 6 ARG A 10 ? ? -170.90 108.81 56 6 ASN A 17 ? ? -42.95 161.88 57 6 PRO A 19 ? ? -69.72 90.70 58 6 ASP A 32 ? ? 74.71 44.84 59 6 ALA A 39 ? ? -37.59 -37.03 60 6 ARG A 58 ? ? -34.36 148.24 61 6 GLN A 59 ? ? -82.70 40.52 62 6 GLU A 60 ? ? 34.37 52.90 63 6 LYS A 68 ? ? -170.12 135.10 64 6 GLN A 69 ? ? -174.77 133.89 65 6 LYS A 70 ? ? -174.74 129.95 66 6 ALA A 77 ? ? -129.67 -57.62 67 7 ASN A 17 ? ? -173.34 149.03 68 7 ARG A 20 ? ? -126.43 -60.70 69 7 ARG A 55 ? ? -39.83 -31.07 70 7 ARG A 58 ? ? -54.67 178.05 71 7 GLN A 64 ? ? -133.46 -44.57 72 7 LEU A 66 ? ? -40.17 101.62 73 8 LEU A 8 ? ? -128.87 -62.97 74 8 ILE A 13 ? ? -174.46 118.68 75 8 PRO A 19 ? ? -69.81 85.64 76 8 LEU A 21 ? ? -174.44 138.11 77 8 ALA A 56 ? ? -69.32 83.83 78 8 GLN A 64 ? ? -59.29 -179.81 79 8 LEU A 66 ? ? -39.62 139.09 80 9 PHE A 12 ? ? -39.89 110.53 81 9 PRO A 19 ? ? -69.69 -173.41 82 9 ARG A 20 ? ? 71.00 54.97 83 9 THR A 25 ? ? -37.64 144.88 84 9 LYS A 29 ? ? -87.10 35.17 85 9 HIS A 30 ? ? -132.61 -41.68 86 9 ALA A 39 ? ? -37.34 -37.62 87 9 GLU A 60 ? ? -170.15 105.09 88 10 SER A 6 ? ? -34.85 112.29 89 10 LEU A 8 ? ? -174.19 119.59 90 10 ARG A 20 ? ? -86.82 42.11 91 10 ASN A 23 ? ? -53.96 174.64 92 10 THR A 25 ? ? -34.33 131.34 93 10 HIS A 48 ? ? -43.99 -71.21 94 10 GLN A 59 ? ? -170.99 106.58 95 10 LYS A 68 ? ? -99.41 41.62 96 10 GLN A 69 ? ? -54.24 175.30 97 10 ALA A 72 ? ? -171.83 144.53 98 10 GLU A 82 ? ? 35.12 41.86 99 10 PRO A 85 ? ? -69.72 -178.42 100 11 SER A 2 ? ? -130.98 -64.10 101 11 ILE A 14 ? ? -28.17 141.41 102 11 PRO A 19 ? ? -69.71 98.86 103 11 SER A 24 ? ? -87.98 42.03 104 11 THR A 25 ? ? -50.30 171.73 105 11 ALA A 39 ? ? -39.35 -39.01 106 11 ALA A 56 ? ? 39.25 37.73 107 11 GLN A 59 ? ? -47.81 167.07 108 11 ARG A 61 ? ? -174.12 141.46 109 11 ARG A 62 ? ? -35.98 109.60 110 11 SER A 67 ? ? -171.02 128.44 111 11 SER A 83 ? ? -129.21 -60.18 112 12 LEU A 8 ? ? -174.65 108.09 113 12 SER A 24 ? ? 34.27 40.87 114 12 LYS A 63 ? ? -174.67 124.76 115 12 TYR A 71 ? ? -97.52 38.61 116 12 SER A 83 ? ? -121.52 -52.17 117 13 LYS A 9 ? ? -38.18 132.53 118 13 ALA A 56 ? ? -85.15 37.34 119 13 LYS A 57 ? ? -49.83 157.56 120 13 GLU A 60 ? ? -86.03 34.37 121 13 LYS A 63 ? ? -174.91 137.21 122 13 ASP A 73 ? ? -120.99 -57.80 123 13 PHE A 76 ? ? -121.03 -61.03 124 13 ASP A 78 ? ? -168.58 113.39 125 13 SER A 87 ? ? -171.46 121.45 126 14 LEU A 8 ? ? -172.64 120.49 127 14 SER A 24 ? ? 35.74 39.87 128 14 LYS A 29 ? ? -90.92 32.62 129 14 ASP A 32 ? ? 74.42 46.02 130 14 SER A 37 ? ? -173.67 -177.81 131 14 ALA A 39 ? ? -31.68 -36.92 132 14 ARG A 55 ? ? -38.75 -32.28 133 14 ALA A 56 ? ? -84.15 44.76 134 14 LYS A 63 ? ? -50.77 -176.00 135 14 SER A 83 ? ? -173.28 148.71 136 14 SER A 87 ? ? -92.33 -64.31 137 15 LYS A 9 ? ? -39.46 147.81 138 15 ARG A 20 ? ? -59.42 92.10 139 15 LEU A 21 ? ? -105.17 -61.56 140 15 LYS A 29 ? ? -84.25 31.33 141 15 ASP A 32 ? ? 74.76 42.51 142 15 ALA A 39 ? ? -36.38 -39.22 143 15 LYS A 57 ? ? -46.16 151.44 144 15 SER A 67 ? ? -117.21 -74.94 145 15 GLN A 69 ? ? -133.41 -72.48 146 15 ALA A 72 ? ? -162.29 110.12 147 15 ALA A 77 ? ? -172.20 147.09 148 15 GLU A 82 ? ? -84.91 42.37 149 16 PRO A 19 ? ? -69.72 98.25 150 16 ALA A 56 ? ? -34.67 -32.38 151 16 GLN A 59 ? ? 38.45 42.80 152 16 ARG A 62 ? ? -133.16 -66.38 153 16 LYS A 63 ? ? 33.01 46.30 154 16 LYS A 68 ? ? -89.33 -72.48 155 16 LYS A 70 ? ? -88.93 39.13 156 16 ALA A 75 ? ? -173.95 138.15 157 17 SER A 2 ? ? 38.38 42.08 158 17 SER A 3 ? ? -49.07 162.54 159 17 ARG A 20 ? ? -99.43 40.21 160 17 ASP A 32 ? ? 74.79 45.10 161 17 ALA A 39 ? ? -34.63 -37.59 162 17 ARG A 62 ? ? -64.48 82.37 163 17 LEU A 66 ? ? -165.29 111.21 164 17 ALA A 75 ? ? 71.99 40.92 165 17 GLU A 82 ? ? -34.51 136.71 166 18 SER A 24 ? ? -103.56 41.25 167 18 ALA A 39 ? ? -33.11 -35.68 168 18 LYS A 63 ? ? -164.20 117.68 169 18 PRO A 85 ? ? -69.75 -172.29 170 19 LEU A 8 ? ? -174.19 121.45 171 19 LYS A 9 ? ? -174.69 131.24 172 19 SER A 24 ? ? -53.55 107.45 173 19 GLN A 59 ? ? -49.29 168.69 174 19 ALA A 72 ? ? -65.72 -178.73 175 19 ALA A 75 ? ? -101.77 -63.56 176 19 PRO A 85 ? ? -69.74 -172.90 177 20 SER A 2 ? ? 35.03 41.68 178 20 ALA A 39 ? ? -36.01 -38.58 179 20 LYS A 57 ? ? -81.11 42.02 180 20 ARG A 58 ? ? 37.60 45.10 181 20 ALA A 75 ? ? 74.73 54.99 182 20 ASP A 78 ? ? -174.85 137.74 183 20 LYS A 80 ? ? 75.00 50.86 184 20 GLU A 82 ? ? -174.87 123.09 185 20 SER A 83 ? ? -90.37 -62.38 186 20 PRO A 85 ? ? -69.80 -171.67 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #