data_1XOA # _entry.id 1XOA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1XOA WWPDB D_1000177298 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1XOA _pdbx_database_status.recvd_initial_deposition_date 1995-11-28 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jeng, M.-F.' 1 'Campbell, A.P.' 2 'Begley, T.' 3 'Holmgren, A.' 4 'Case, D.A.' 5 'Wright, P.E.' 6 'Dyson, H.J.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'High-resolution solution structures of oxidized and reduced Escherichia coli thioredoxin.' Structure 2 853 868 1994 STRUE6 UK 0969-2126 2005 ? 7812718 '10.1016/S0969-2126(94)00086-7' 1 'Effect of Disulfide Bridge Formation on the NMR Spectrum of a Protein: Studies on Oxidized and Reduced Escherichia Coli Thioredoxin' J.Biomol.NMR 4 411 ? 1994 JBNME9 NE 0925-2738 0800 ? ? ? 2 'Assignment of the 15N NMR Spectra of Reduced and Oxidized Escherichia Coli Thioredoxin' 'FEBS Lett.' 284 178 ? 1991 FEBLAL NE 0014-5793 0165 ? ? ? 3 ;Three-Dimensional Solution Structure of the Reduced Form of Escherichia Coli Thioredoxin Determined by Nuclear Magnetic Resonance Spectroscopy ; Biochemistry 29 4129 ? 1990 BICHAW US 0006-2960 0033 ? ? ? 4 ;Assignment of the Proton NMR Spectrum of Reduced and Oxidized Thioredoxin: Sequence-Specific Assignments, Secondary Structure, and Global Fold ; Biochemistry 28 7074 ? 1989 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Jeng, M.F.' 1 primary 'Campbell, A.P.' 2 primary 'Begley, T.' 3 primary 'Holmgren, A.' 4 primary 'Case, D.A.' 5 primary 'Wright, P.E.' 6 primary 'Dyson, H.J.' 7 1 'Chandrasekhar, K.' 8 1 'Campbell, A.P.' 9 1 'Jeng, M.F.' 10 1 'Holmgren, A.' 11 1 'Dyson, H.J.' 12 2 'Chandrasekhar, K.' 13 2 'Krause, G.' 14 2 'Holmgren, A.' 15 2 'Dyson, H.J.' 16 3 'Dyson, H.J.' 17 3 'Gippert, G.P.' 18 3 'Case, D.A.' 19 3 'Holmgren, A.' 20 3 'Wright, P.E.' 21 4 'Dyson, H.J.' 22 4 'Holmgren, A.' 23 4 'Wright, P.E.' 24 # _cell.entry_id 1XOA _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1XOA _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description THIOREDOXIN _entity.formula_weight 11687.388 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'OXIDIZED DISULFIDE FORM' # _entity_name_com.entity_id 1 _entity_name_com.name TRX-S2 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL FKNGEVAATKVGALSKGQLKEFLDANLA ; _entity_poly.pdbx_seq_one_letter_code_can ;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL FKNGEVAATKVGALSKGQLKEFLDANLA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASP n 1 3 LYS n 1 4 ILE n 1 5 ILE n 1 6 HIS n 1 7 LEU n 1 8 THR n 1 9 ASP n 1 10 ASP n 1 11 SER n 1 12 PHE n 1 13 ASP n 1 14 THR n 1 15 ASP n 1 16 VAL n 1 17 LEU n 1 18 LYS n 1 19 ALA n 1 20 ASP n 1 21 GLY n 1 22 ALA n 1 23 ILE n 1 24 LEU n 1 25 VAL n 1 26 ASP n 1 27 PHE n 1 28 TRP n 1 29 ALA n 1 30 GLU n 1 31 TRP n 1 32 CYS n 1 33 GLY n 1 34 PRO n 1 35 CYS n 1 36 LYS n 1 37 MET n 1 38 ILE n 1 39 ALA n 1 40 PRO n 1 41 ILE n 1 42 LEU n 1 43 ASP n 1 44 GLU n 1 45 ILE n 1 46 ALA n 1 47 ASP n 1 48 GLU n 1 49 TYR n 1 50 GLN n 1 51 GLY n 1 52 LYS n 1 53 LEU n 1 54 THR n 1 55 VAL n 1 56 ALA n 1 57 LYS n 1 58 LEU n 1 59 ASN n 1 60 ILE n 1 61 ASP n 1 62 GLN n 1 63 ASN n 1 64 PRO n 1 65 GLY n 1 66 THR n 1 67 ALA n 1 68 PRO n 1 69 LYS n 1 70 TYR n 1 71 GLY n 1 72 ILE n 1 73 ARG n 1 74 GLY n 1 75 ILE n 1 76 PRO n 1 77 THR n 1 78 LEU n 1 79 LEU n 1 80 LEU n 1 81 PHE n 1 82 LYS n 1 83 ASN n 1 84 GLY n 1 85 GLU n 1 86 VAL n 1 87 ALA n 1 88 ALA n 1 89 THR n 1 90 LYS n 1 91 VAL n 1 92 GLY n 1 93 ALA n 1 94 LEU n 1 95 SER n 1 96 LYS n 1 97 GLY n 1 98 GLN n 1 99 LEU n 1 100 LYS n 1 101 GLU n 1 102 PHE n 1 103 LEU n 1 104 ASP n 1 105 ALA n 1 106 ASN n 1 107 LEU n 1 108 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain C1A _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PBHK8 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code THIO_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P0AA25 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL FKNGEVAATKVGALSKGQLKEFLDANLA ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1XOA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 108 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0AA25 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 108 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1XOA _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name AMBER _pdbx_nmr_software.version ? _pdbx_nmr_software.authors PEARLMAN,CASE,CALDWELL,SIEBEL,SINGH,WEINER,KOLLMAN _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1XOA _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1XOA _struct.title 'THIOREDOXIN (OXIDIZED DISULFIDE FORM), NMR, 20 STRUCTURES' _struct.pdbx_descriptor THIOREDOXIN _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1XOA _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'ELECTRON TRANSPORT, REDOX-ACTIVE CENTER' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 SER A 11 ? LEU A 17 ? SER A 11 LEU A 17 1 ? 7 HELX_P HELX_P2 H2 GLY A 33 ? GLU A 48 ? GLY A 33 GLU A 48 1 ? 16 HELX_P HELX_P3 H3 ILE A 60 ? LYS A 69 ? ILE A 60 LYS A 69 5 DISTORTED 10 HELX_P HELX_P4 H4 LYS A 96 ? LEU A 107 ? LYS A 96 LEU A 107 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 32 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 35 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 32 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 35 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.070 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ILE 75 A . ? ILE 75 A PRO 76 A ? PRO 76 A 1 -0.40 2 ILE 75 A . ? ILE 75 A PRO 76 A ? PRO 76 A 2 -0.88 3 ILE 75 A . ? ILE 75 A PRO 76 A ? PRO 76 A 3 -0.39 4 ILE 75 A . ? ILE 75 A PRO 76 A ? PRO 76 A 4 -1.17 5 ILE 75 A . ? ILE 75 A PRO 76 A ? PRO 76 A 5 -0.64 6 ILE 75 A . ? ILE 75 A PRO 76 A ? PRO 76 A 6 -0.61 7 ILE 75 A . ? ILE 75 A PRO 76 A ? PRO 76 A 7 -0.64 8 ILE 75 A . ? ILE 75 A PRO 76 A ? PRO 76 A 8 -1.21 9 ILE 75 A . ? ILE 75 A PRO 76 A ? PRO 76 A 9 -0.73 10 ILE 75 A . ? ILE 75 A PRO 76 A ? PRO 76 A 10 -0.95 11 ILE 75 A . ? ILE 75 A PRO 76 A ? PRO 76 A 11 -0.93 12 ILE 75 A . ? ILE 75 A PRO 76 A ? PRO 76 A 12 -1.06 13 ILE 75 A . ? ILE 75 A PRO 76 A ? PRO 76 A 13 -0.94 14 ILE 75 A . ? ILE 75 A PRO 76 A ? PRO 76 A 14 -1.29 15 ILE 75 A . ? ILE 75 A PRO 76 A ? PRO 76 A 15 -0.66 16 ILE 75 A . ? ILE 75 A PRO 76 A ? PRO 76 A 16 -0.64 17 ILE 75 A . ? ILE 75 A PRO 76 A ? PRO 76 A 17 -0.84 18 ILE 75 A . ? ILE 75 A PRO 76 A ? PRO 76 A 18 -1.40 19 ILE 75 A . ? ILE 75 A PRO 76 A ? PRO 76 A 19 -0.78 20 ILE 75 A . ? ILE 75 A PRO 76 A ? PRO 76 A 20 -2.06 # _struct_sheet.id B1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense B1 1 2 ? parallel B1 2 3 ? parallel B1 3 4 ? anti-parallel B1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id B1 1 ILE A 4 ? THR A 8 ? ILE A 4 THR A 8 B1 2 LEU A 53 ? ASN A 59 ? LEU A 53 ASN A 59 B1 3 ALA A 22 ? ALA A 29 ? ALA A 22 ALA A 29 B1 4 PRO A 76 ? LYS A 82 ? PRO A 76 LYS A 82 B1 5 ALA A 88 ? GLY A 92 ? ALA A 88 GLY A 92 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id B1 1 2 O ILE A 5 ? O ILE A 5 N LYS A 57 ? N LYS A 57 B1 2 3 O ALA A 56 ? O ALA A 56 N ASP A 26 ? N ASP A 26 B1 3 4 O VAL A 25 ? O VAL A 25 N LEU A 79 ? N LEU A 79 B1 4 5 O LEU A 78 ? O LEU A 78 N LYS A 90 ? N LYS A 90 # _database_PDB_matrix.entry_id 1XOA _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1XOA _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 TRP 28 28 28 TRP TRP A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 ALA 108 108 108 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-06-10 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf 5 4 'Structure model' struct_conf_type # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -158.57 -137.21 2 1 LYS A 3 ? ? -95.27 53.75 3 2 ASP A 2 ? ? -69.75 72.35 4 2 LYS A 3 ? ? -103.43 50.28 5 2 ALA A 19 ? ? -66.08 73.42 6 3 ASP A 2 ? ? 39.59 -100.75 7 3 LYS A 18 ? ? -96.22 30.43 8 3 ALA A 19 ? ? -65.21 74.78 9 3 ASN A 63 ? ? -118.30 67.78 10 4 ASP A 2 ? ? 34.55 -95.94 11 4 LYS A 18 ? ? -96.48 32.48 12 4 ALA A 19 ? ? -69.40 66.86 13 5 VAL A 16 ? ? -101.15 -63.47 14 6 VAL A 16 ? ? -97.35 -65.13 15 6 GLN A 50 ? ? -58.53 99.83 16 7 LYS A 3 ? ? -103.82 47.74 17 7 ALA A 19 ? ? -69.32 72.93 18 7 ASP A 20 ? ? -67.56 73.58 19 7 TYR A 49 ? ? -87.11 30.14 20 8 LYS A 18 ? ? -105.52 40.54 21 9 ASP A 2 ? ? 5.21 -85.79 22 9 LYS A 18 ? ? -96.79 32.64 23 9 ASN A 63 ? ? -118.85 67.49 24 10 ASP A 2 ? ? 35.13 -92.28 25 10 GLN A 50 ? ? -59.23 101.71 26 11 ALA A 19 ? ? -68.89 73.22 27 11 ASP A 20 ? ? -68.09 73.49 28 12 ASN A 63 ? ? -117.64 71.14 29 14 ASP A 2 ? ? 3.54 -84.21 30 14 VAL A 16 ? ? -107.46 -65.21 31 15 GLN A 50 ? ? -60.60 88.88 32 17 ASP A 2 ? ? 59.06 -91.69 33 17 VAL A 16 ? ? -107.98 -63.01 34 18 ASP A 2 ? ? -66.32 98.58 35 19 ASN A 63 ? ? -119.42 70.13 36 20 ASP A 2 ? ? -58.78 98.92 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 73 ? ? 0.094 'SIDE CHAIN' 2 2 HIS A 6 ? ? 0.085 'SIDE CHAIN' 3 2 TYR A 70 ? ? 0.067 'SIDE CHAIN' 4 3 TYR A 70 ? ? 0.087 'SIDE CHAIN' 5 3 ARG A 73 ? ? 0.096 'SIDE CHAIN' 6 4 HIS A 6 ? ? 0.072 'SIDE CHAIN' 7 4 TYR A 70 ? ? 0.085 'SIDE CHAIN' 8 5 TYR A 70 ? ? 0.098 'SIDE CHAIN' 9 5 ARG A 73 ? ? 0.107 'SIDE CHAIN' 10 6 HIS A 6 ? ? 0.083 'SIDE CHAIN' 11 6 TYR A 49 ? ? 0.066 'SIDE CHAIN' 12 6 ARG A 73 ? ? 0.104 'SIDE CHAIN' 13 8 HIS A 6 ? ? 0.075 'SIDE CHAIN' 14 8 TYR A 70 ? ? 0.117 'SIDE CHAIN' 15 9 HIS A 6 ? ? 0.072 'SIDE CHAIN' 16 9 TYR A 70 ? ? 0.099 'SIDE CHAIN' 17 10 HIS A 6 ? ? 0.079 'SIDE CHAIN' 18 11 HIS A 6 ? ? 0.085 'SIDE CHAIN' 19 11 TYR A 70 ? ? 0.108 'SIDE CHAIN' 20 11 ARG A 73 ? ? 0.091 'SIDE CHAIN' 21 12 HIS A 6 ? ? 0.083 'SIDE CHAIN' 22 12 TYR A 49 ? ? 0.095 'SIDE CHAIN' 23 12 TYR A 70 ? ? 0.065 'SIDE CHAIN' 24 13 HIS A 6 ? ? 0.084 'SIDE CHAIN' 25 14 HIS A 6 ? ? 0.071 'SIDE CHAIN' 26 15 HIS A 6 ? ? 0.082 'SIDE CHAIN' 27 15 ARG A 73 ? ? 0.090 'SIDE CHAIN' 28 16 HIS A 6 ? ? 0.071 'SIDE CHAIN' 29 16 ARG A 73 ? ? 0.113 'SIDE CHAIN' 30 17 HIS A 6 ? ? 0.086 'SIDE CHAIN' 31 17 TYR A 70 ? ? 0.084 'SIDE CHAIN' 32 17 ARG A 73 ? ? 0.077 'SIDE CHAIN' 33 18 HIS A 6 ? ? 0.074 'SIDE CHAIN' 34 18 TYR A 70 ? ? 0.072 'SIDE CHAIN' 35 18 ARG A 73 ? ? 0.107 'SIDE CHAIN' 36 19 HIS A 6 ? ? 0.082 'SIDE CHAIN' 37 20 HIS A 6 ? ? 0.070 'SIDE CHAIN' 38 20 TYR A 70 ? ? 0.070 'SIDE CHAIN' #