data_1YUB # _entry.id 1YUB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1YUB pdb_00001yub 10.2210/pdb1yub/pdb WWPDB D_1000177444 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1YUB _pdbx_database_status.recvd_initial_deposition_date 1997-03-04 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yu, L.' 1 'Petros, A.M.' 2 'Schnuchel, A.' 3 'Zhong, P.' 4 'Severin, J.M.' 5 'Walter, K.' 6 'Holzman, T.F.' 7 'Fesik, S.W.' 8 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure of an rRNA methyltransferase (ErmAM) that confers macrolide-lincosamide-streptogramin antibiotic resistance.' Nat.Struct.Biol. 4 483 489 1997 NSBIEW US 1072-8368 2024 ? 9187657 10.1038/nsb0697-483 1 ;Erratum. Solution Structure of an Rrna Methyltransferase (Ermam) that Confers Macrolide-Lincosamide-Streptogramin Antibiotic Resistance ; Nat.Struct.Biol. 4 592 ? 1997 NSBIEW US 1072-8368 2024 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yu, L.' 1 ? primary 'Petros, A.M.' 2 ? primary 'Schnuchel, A.' 3 ? primary 'Zhong, P.' 4 ? primary 'Severin, J.M.' 5 ? primary 'Walter, K.' 6 ? primary 'Holzman, T.F.' 7 ? primary 'Fesik, S.W.' 8 ? 1 'Yu, L.' 9 ? 1 'Petros, A.M.' 10 ? 1 'Schnuchel, A.' 11 ? 1 'Zhong, P.' 12 ? 1 'Severin, J.M.' 13 ? 1 'Walter, K.' 14 ? 1 'Holzman, T.F.' 15 ? 1 'Fesik, S.W.' 16 ? # _cell.entry_id 1YUB _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1YUB _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'RRNA METHYLTRANSFERASE' _entity.formula_weight 28862.568 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.1.1.48 _entity.pdbx_mutation 'I75T, S100N, H118R' _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ERMAM # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELDSHLFNLSSEKLKLNTRVTLI HQDILQFQFPNKQRYKIVGNIPYHLSTQIIKKVVFESRASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAE CFHPKPKVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNNLSTITYEQVLSIFNSYLL FNGRK ; _entity_poly.pdbx_seq_one_letter_code_can ;MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELDSHLFNLSSEKLKLNTRVTLI HQDILQFQFPNKQRYKIVGNIPYHLSTQIIKKVVFESRASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAE CFHPKPKVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNNLSTITYEQVLSIFNSYLL FNGRK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 LYS n 1 4 ASN n 1 5 ILE n 1 6 LYS n 1 7 TYR n 1 8 SER n 1 9 GLN n 1 10 ASN n 1 11 PHE n 1 12 LEU n 1 13 THR n 1 14 SER n 1 15 GLU n 1 16 LYS n 1 17 VAL n 1 18 LEU n 1 19 ASN n 1 20 GLN n 1 21 ILE n 1 22 ILE n 1 23 LYS n 1 24 GLN n 1 25 LEU n 1 26 ASN n 1 27 LEU n 1 28 LYS n 1 29 GLU n 1 30 THR n 1 31 ASP n 1 32 THR n 1 33 VAL n 1 34 TYR n 1 35 GLU n 1 36 ILE n 1 37 GLY n 1 38 THR n 1 39 GLY n 1 40 LYS n 1 41 GLY n 1 42 HIS n 1 43 LEU n 1 44 THR n 1 45 THR n 1 46 LYS n 1 47 LEU n 1 48 ALA n 1 49 LYS n 1 50 ILE n 1 51 SER n 1 52 LYS n 1 53 GLN n 1 54 VAL n 1 55 THR n 1 56 SER n 1 57 ILE n 1 58 GLU n 1 59 LEU n 1 60 ASP n 1 61 SER n 1 62 HIS n 1 63 LEU n 1 64 PHE n 1 65 ASN n 1 66 LEU n 1 67 SER n 1 68 SER n 1 69 GLU n 1 70 LYS n 1 71 LEU n 1 72 LYS n 1 73 LEU n 1 74 ASN n 1 75 THR n 1 76 ARG n 1 77 VAL n 1 78 THR n 1 79 LEU n 1 80 ILE n 1 81 HIS n 1 82 GLN n 1 83 ASP n 1 84 ILE n 1 85 LEU n 1 86 GLN n 1 87 PHE n 1 88 GLN n 1 89 PHE n 1 90 PRO n 1 91 ASN n 1 92 LYS n 1 93 GLN n 1 94 ARG n 1 95 TYR n 1 96 LYS n 1 97 ILE n 1 98 VAL n 1 99 GLY n 1 100 ASN n 1 101 ILE n 1 102 PRO n 1 103 TYR n 1 104 HIS n 1 105 LEU n 1 106 SER n 1 107 THR n 1 108 GLN n 1 109 ILE n 1 110 ILE n 1 111 LYS n 1 112 LYS n 1 113 VAL n 1 114 VAL n 1 115 PHE n 1 116 GLU n 1 117 SER n 1 118 ARG n 1 119 ALA n 1 120 SER n 1 121 ASP n 1 122 ILE n 1 123 TYR n 1 124 LEU n 1 125 ILE n 1 126 VAL n 1 127 GLU n 1 128 GLU n 1 129 GLY n 1 130 PHE n 1 131 TYR n 1 132 LYS n 1 133 ARG n 1 134 THR n 1 135 LEU n 1 136 ASP n 1 137 ILE n 1 138 HIS n 1 139 ARG n 1 140 THR n 1 141 LEU n 1 142 GLY n 1 143 LEU n 1 144 LEU n 1 145 LEU n 1 146 HIS n 1 147 THR n 1 148 GLN n 1 149 VAL n 1 150 SER n 1 151 ILE n 1 152 GLN n 1 153 GLN n 1 154 LEU n 1 155 LEU n 1 156 LYS n 1 157 LEU n 1 158 PRO n 1 159 ALA n 1 160 GLU n 1 161 CYS n 1 162 PHE n 1 163 HIS n 1 164 PRO n 1 165 LYS n 1 166 PRO n 1 167 LYS n 1 168 VAL n 1 169 ASN n 1 170 SER n 1 171 VAL n 1 172 LEU n 1 173 ILE n 1 174 LYS n 1 175 LEU n 1 176 THR n 1 177 ARG n 1 178 HIS n 1 179 THR n 1 180 THR n 1 181 ASP n 1 182 VAL n 1 183 PRO n 1 184 ASP n 1 185 LYS n 1 186 TYR n 1 187 TRP n 1 188 LYS n 1 189 LEU n 1 190 TYR n 1 191 THR n 1 192 TYR n 1 193 PHE n 1 194 VAL n 1 195 SER n 1 196 LYS n 1 197 TRP n 1 198 VAL n 1 199 ASN n 1 200 ARG n 1 201 GLU n 1 202 TYR n 1 203 ARG n 1 204 GLN n 1 205 LEU n 1 206 PHE n 1 207 THR n 1 208 LYS n 1 209 ASN n 1 210 GLN n 1 211 PHE n 1 212 HIS n 1 213 GLN n 1 214 ALA n 1 215 MET n 1 216 LYS n 1 217 HIS n 1 218 ALA n 1 219 LYS n 1 220 VAL n 1 221 ASN n 1 222 ASN n 1 223 LEU n 1 224 SER n 1 225 THR n 1 226 ILE n 1 227 THR n 1 228 TYR n 1 229 GLU n 1 230 GLN n 1 231 VAL n 1 232 LEU n 1 233 SER n 1 234 ILE n 1 235 PHE n 1 236 ASN n 1 237 SER n 1 238 TYR n 1 239 LEU n 1 240 LEU n 1 241 PHE n 1 242 ASN n 1 243 GLY n 1 244 ARG n 1 245 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Streptococcus _entity_src_gen.pdbx_gene_src_gene ERM _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain '5728, A CLINICAL ISOLATE FROM ABBOTT CULTURE COLLECTION' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptococcus pneumoniae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1313 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ERM _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PET-24(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ERM_STRPN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P21236 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELDSHLFNLSSEKLKLNTRVTLI HQDILQFQFPNKQRYKIVGNIPYHLSTQIIKKVVFESRASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAE CFHPKPKVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNNLSTITYEQVLSIFNSYLL FNGRKQLPIF ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1YUB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 245 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P21236 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 245 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 245 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 2D 1 2 1 3D 1 3 1 '4D NMR' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50 mM SODIUM PHOSPHATE, 100 mM NACL' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 DMX500 Bruker 500 2 AMX600 Bruker 600 3 DRX800 Bruker 800 # _pdbx_nmr_refine.entry_id 1YUB _pdbx_nmr_refine.method DG/SA _pdbx_nmr_refine.details 'THE TOTAL NUMBER OF DISTANCE RESTRAINTS USED WAS 3259. THE TOTAL NUMBER OF TORSIONAL RESTRAINTS USED WAS 63.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1YUB _pdbx_nmr_ensemble.conformers_calculated_total_number 17 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST ENERGY AND LEAST RESTRAINT VIOLATION' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' X-PLOR 3.1 ? 2 # _exptl.entry_id 1YUB _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1YUB _struct.title ;SOLUTION STRUCTURE OF AN RRNA METHYLTRANSFERASE (ERMAM) THAT CONFERS MACROLIDE-LINCOSAMIDE-STREPTOGRAMIN ANTIBIOTIC RESISTANCE, NMR, MINIMIZED AVERAGE STRUCTURE ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1YUB _struct_keywords.pdbx_keywords METHYLTRANSFERASE _struct_keywords.text 'METHYLTRANSFERASE, ERM, ERMAM, MLS ANTIBIOTICS, RRNA' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 LYS A 16 ? LEU A 25 ? LYS A 16 LEU A 25 1 ? 10 HELX_P HELX_P2 H2 LEU A 43 ? ILE A 50 ? LEU A 43 ILE A 50 1 ? 8 HELX_P HELX_P3 H3 HIS A 62 ? ASN A 65 ? HIS A 62 ASN A 65 1 ? 4 HELX_P HELX_P4 H4 LEU A 85 ? GLN A 88 ? LEU A 85 GLN A 88 1 ? 4 HELX_P HELX_P5 H5 SER A 106 ? GLU A 116 ? SER A 106 GLU A 116 1 ? 11 HELX_P HELX_P6 H6 GLY A 129 ? ASP A 136 ? GLY A 129 ASP A 136 1 ? 8 HELX_P HELX_P7 H7 THR A 140 ? HIS A 146 ? THR A 140 HIS A 146 1 ? 7 HELX_P HELX_P8 H8 TYR A 186 ? ASN A 199 ? TYR A 186 ASN A 199 1 ? 14 HELX_P HELX_P9 H9 TYR A 202 ? LEU A 205 ? TYR A 202 LEU A 205 1 ? 4 HELX_P HELX_P10 H10 GLN A 210 ? ALA A 218 ? GLN A 210 ALA A 218 1 ? 9 HELX_P HELX_P11 H11 TYR A 228 ? PHE A 241 ? TYR A 228 PHE A 241 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id HIS _struct_mon_prot_cis.label_seq_id 163 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id HIS _struct_mon_prot_cis.auth_seq_id 163 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 164 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 164 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.16 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details SH1 ? 7 ? SH2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense SH1 1 2 ? parallel SH1 2 3 ? parallel SH1 3 4 ? parallel SH1 4 5 ? parallel SH1 5 6 ? anti-parallel SH1 6 7 ? anti-parallel SH2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id SH1 1 ARG A 76 ? ILE A 80 ? ARG A 76 ILE A 80 SH1 2 GLN A 53 ? ILE A 57 ? GLN A 53 ILE A 57 SH1 3 THR A 32 ? ILE A 36 ? THR A 32 ILE A 36 SH1 4 TYR A 95 ? ASN A 100 ? TYR A 95 ASN A 100 SH1 5 SER A 120 ? GLU A 127 ? SER A 120 GLU A 127 SH1 6 SER A 170 ? ARG A 177 ? SER A 170 ARG A 177 SH1 7 VAL A 149 ? LYS A 156 ? VAL A 149 LYS A 156 SH2 1 PHE A 11 ? THR A 13 ? PHE A 11 THR A 13 SH2 2 CYS A 161 ? HIS A 163 ? CYS A 161 HIS A 163 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id SH1 1 2 O THR A 78 ? O THR A 78 N SER A 56 ? N SER A 56 SH1 2 3 O GLN A 53 ? O GLN A 53 N VAL A 33 ? N VAL A 33 SH1 3 4 O TYR A 34 ? O TYR A 34 N VAL A 98 ? N VAL A 98 SH1 4 5 O ILE A 97 ? O ILE A 97 N TYR A 123 ? N TYR A 123 SH1 5 6 O LEU A 124 ? O LEU A 124 N ILE A 173 ? N ILE A 173 SH1 6 7 O LYS A 174 ? O LYS A 174 N GLN A 152 ? N GLN A 152 SH2 1 2 N PHE A 11 ? N PHE A 11 O HIS A 163 ? O HIS A 163 # _database_PDB_matrix.entry_id 1YUB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1YUB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 TYR 131 131 131 TYR TYR A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 HIS 138 138 138 HIS HIS A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 HIS 146 146 146 HIS HIS A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 GLN 148 148 148 GLN GLN A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 GLN 153 153 153 GLN GLN A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 PRO 158 158 158 PRO PRO A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 CYS 161 161 161 CYS CYS A . n A 1 162 PHE 162 162 162 PHE PHE A . n A 1 163 HIS 163 163 163 HIS HIS A . n A 1 164 PRO 164 164 164 PRO PRO A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 PRO 166 166 166 PRO PRO A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 ASN 169 169 169 ASN ASN A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 ILE 173 173 173 ILE ILE A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 THR 176 176 176 THR THR A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 HIS 178 178 178 HIS HIS A . n A 1 179 THR 179 179 179 THR THR A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 ASP 181 181 181 ASP ASP A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 PRO 183 183 183 PRO PRO A . n A 1 184 ASP 184 184 184 ASP ASP A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 TYR 186 186 186 TYR TYR A . n A 1 187 TRP 187 187 187 TRP TRP A . n A 1 188 LYS 188 188 188 LYS LYS A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 TYR 190 190 190 TYR TYR A . n A 1 191 THR 191 191 191 THR THR A . n A 1 192 TYR 192 192 192 TYR TYR A . n A 1 193 PHE 193 193 193 PHE PHE A . n A 1 194 VAL 194 194 194 VAL VAL A . n A 1 195 SER 195 195 195 SER SER A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 TRP 197 197 197 TRP TRP A . n A 1 198 VAL 198 198 198 VAL VAL A . n A 1 199 ASN 199 199 199 ASN ASN A . n A 1 200 ARG 200 200 200 ARG ARG A . n A 1 201 GLU 201 201 201 GLU GLU A . n A 1 202 TYR 202 202 202 TYR TYR A . n A 1 203 ARG 203 203 203 ARG ARG A . n A 1 204 GLN 204 204 204 GLN GLN A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 PHE 206 206 206 PHE PHE A . n A 1 207 THR 207 207 207 THR THR A . n A 1 208 LYS 208 208 208 LYS LYS A . n A 1 209 ASN 209 209 209 ASN ASN A . n A 1 210 GLN 210 210 210 GLN GLN A . n A 1 211 PHE 211 211 211 PHE PHE A . n A 1 212 HIS 212 212 212 HIS HIS A . n A 1 213 GLN 213 213 213 GLN GLN A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 MET 215 215 215 MET MET A . n A 1 216 LYS 216 216 216 LYS LYS A . n A 1 217 HIS 217 217 217 HIS HIS A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 LYS 219 219 219 LYS LYS A . n A 1 220 VAL 220 220 220 VAL VAL A . n A 1 221 ASN 221 221 221 ASN ASN A . n A 1 222 ASN 222 222 222 ASN ASN A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 SER 224 224 224 SER SER A . n A 1 225 THR 225 225 225 THR THR A . n A 1 226 ILE 226 226 226 ILE ILE A . n A 1 227 THR 227 227 227 THR THR A . n A 1 228 TYR 228 228 228 TYR TYR A . n A 1 229 GLU 229 229 229 GLU GLU A . n A 1 230 GLN 230 230 230 GLN GLN A . n A 1 231 VAL 231 231 231 VAL VAL A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 SER 233 233 233 SER SER A . n A 1 234 ILE 234 234 234 ILE ILE A . n A 1 235 PHE 235 235 235 PHE PHE A . n A 1 236 ASN 236 236 236 ASN ASN A . n A 1 237 SER 237 237 237 SER SER A . n A 1 238 TYR 238 238 238 TYR TYR A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 LEU 240 240 240 LEU LEU A . n A 1 241 PHE 241 241 241 PHE PHE A . n A 1 242 ASN 242 242 242 ASN ASN A . n A 1 243 GLY 243 243 243 GLY GLY A . n A 1 244 ARG 244 244 244 ARG ARG A . n A 1 245 LYS 245 245 245 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-03-04 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 3 ? ? 40.56 -148.79 2 1 ASN A 4 ? ? 175.11 62.99 3 1 LYS A 6 ? ? -115.45 50.43 4 1 TYR A 7 ? ? -125.86 -157.04 5 1 THR A 13 ? ? 24.93 43.29 6 1 ASN A 26 ? ? 46.43 96.32 7 1 LYS A 28 ? ? -92.00 -74.44 8 1 GLU A 29 ? ? 169.85 -35.37 9 1 THR A 32 ? ? -43.58 172.81 10 1 THR A 38 ? ? -115.88 -150.32 11 1 HIS A 42 ? ? -179.35 67.12 12 1 LEU A 43 ? ? 170.01 -174.36 13 1 THR A 44 ? ? 79.37 -74.30 14 1 LEU A 59 ? ? 58.20 156.58 15 1 LEU A 63 ? ? 81.09 -71.28 16 1 SER A 67 ? ? -54.27 88.57 17 1 SER A 68 ? ? 39.49 96.42 18 1 LEU A 71 ? ? -81.47 33.92 19 1 LEU A 73 ? ? 35.69 65.89 20 1 ASN A 74 ? ? -152.58 31.68 21 1 THR A 75 ? ? -114.53 -129.28 22 1 ARG A 76 ? ? -107.68 79.64 23 1 GLN A 82 ? ? 78.55 -154.97 24 1 ASP A 83 ? ? -31.88 139.94 25 1 ILE A 84 ? ? -140.50 -108.31 26 1 LEU A 85 ? ? 45.88 -83.84 27 1 PHE A 89 ? ? -39.04 97.68 28 1 PRO A 90 ? ? -85.42 -159.76 29 1 LYS A 92 ? ? 76.17 146.28 30 1 GLN A 93 ? ? 80.27 -168.77 31 1 TYR A 103 ? ? 81.02 4.24 32 1 LEU A 105 ? ? 169.95 133.30 33 1 SER A 106 ? ? 179.78 -40.60 34 1 GLU A 116 ? ? -141.48 -6.59 35 1 SER A 120 ? ? 83.45 -47.93 36 1 GLU A 128 ? ? 164.07 -84.38 37 1 THR A 134 ? ? -93.66 -63.24 38 1 THR A 140 ? ? 71.03 -5.52 39 1 LEU A 154 ? ? -121.53 -66.89 40 1 ALA A 159 ? ? 81.41 43.11 41 1 PRO A 166 ? ? -48.89 -171.15 42 1 LYS A 167 ? ? -156.09 -43.02 43 1 ARG A 177 ? ? -56.57 101.54 44 1 HIS A 178 ? ? -107.04 -166.71 45 1 THR A 179 ? ? -57.44 -82.50 46 1 THR A 180 ? ? -178.95 128.37 47 1 ASP A 184 ? ? -39.82 -34.27 48 1 VAL A 198 ? ? -100.72 -68.75 49 1 ASN A 199 ? ? -43.95 -72.48 50 1 ARG A 200 ? ? 171.44 35.61 51 1 GLU A 201 ? ? -92.26 46.92 52 1 LYS A 208 ? ? -175.56 52.60 53 1 VAL A 220 ? ? -98.93 55.30 54 1 ILE A 226 ? ? -38.48 142.08 55 1 TYR A 228 ? ? 157.51 -23.41 56 1 ASN A 242 ? ? -81.50 -86.25 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 76 ? ? 0.296 'SIDE CHAIN' 2 1 ARG A 94 ? ? 0.114 'SIDE CHAIN' 3 1 ARG A 118 ? ? 0.278 'SIDE CHAIN' 4 1 ARG A 133 ? ? 0.315 'SIDE CHAIN' 5 1 ARG A 139 ? ? 0.153 'SIDE CHAIN' 6 1 ARG A 177 ? ? 0.300 'SIDE CHAIN' 7 1 ARG A 200 ? ? 0.195 'SIDE CHAIN' 8 1 ARG A 203 ? ? 0.203 'SIDE CHAIN' 9 1 ARG A 244 ? ? 0.269 'SIDE CHAIN' #