data_1ZKH # _entry.id 1ZKH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1ZKH RCSB RCSB032821 WWPDB D_1000032821 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id HS00002 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ZKH _pdbx_database_status.recvd_initial_deposition_date 2005-05-02 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lukin, J.A.' 1 'Dhe-Paganon, S.' 2 'Guido, V.' 3 'Lemak, A.' 4 'Avvakumov, G.V.' 5 'Xue, S.' 6 'Newman, E.M.' 7 'Mackenzie, F.' 8 'Sundstrom, M.' 9 'Edwards, A.' 10 'Arrowsmith, C.H.' 11 'Structural Genomics Consortium (SGC)' 12 # _citation.id primary _citation.title 'Solution structure of a human ubiquitin-like domain in SF3A1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Lukin, J.A.' 1 primary 'Dhe-Paganon, S.' 2 primary 'Guido, V.' 3 primary 'Lemak, A.' 4 primary 'Avvakumov, G.V.' 5 primary 'Xue, S.' 6 primary 'Newman, E.M.' 7 primary 'Mackenzie, F.' 8 primary 'Sundstrom, M.' 9 primary 'Edwards, A.' 10 primary 'Arrowsmith, C.H.' 11 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Splicing factor 3 subunit 1' _entity.formula_weight 9565.140 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Ubiquitin-like domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Spliceosome associated protein 114, SAP 114, SF3a120, SF3A1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHL ALKERG ; _entity_poly.pdbx_seq_one_letter_code_can ;PVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHL ALKERG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 VAL n 1 3 SER n 1 4 ILE n 1 5 LYS n 1 6 VAL n 1 7 GLN n 1 8 VAL n 1 9 PRO n 1 10 ASN n 1 11 MET n 1 12 GLN n 1 13 ASP n 1 14 LYS n 1 15 THR n 1 16 GLU n 1 17 TRP n 1 18 LYS n 1 19 LEU n 1 20 ASN n 1 21 GLY n 1 22 GLN n 1 23 VAL n 1 24 LEU n 1 25 VAL n 1 26 PHE n 1 27 THR n 1 28 LEU n 1 29 PRO n 1 30 LEU n 1 31 THR n 1 32 ASP n 1 33 GLN n 1 34 VAL n 1 35 SER n 1 36 VAL n 1 37 ILE n 1 38 LYS n 1 39 VAL n 1 40 LYS n 1 41 ILE n 1 42 HIS n 1 43 GLU n 1 44 ALA n 1 45 THR n 1 46 GLY n 1 47 MET n 1 48 PRO n 1 49 ALA n 1 50 GLY n 1 51 LYS n 1 52 GLN n 1 53 LYS n 1 54 LEU n 1 55 GLN n 1 56 TYR n 1 57 GLU n 1 58 GLY n 1 59 ILE n 1 60 PHE n 1 61 ILE n 1 62 LYS n 1 63 ASP n 1 64 SER n 1 65 ASN n 1 66 SER n 1 67 LEU n 1 68 ALA n 1 69 TYR n 1 70 TYR n 1 71 ASN n 1 72 MET n 1 73 ALA n 1 74 ASN n 1 75 GLY n 1 76 ALA n 1 77 VAL n 1 78 ILE n 1 79 HIS n 1 80 LEU n 1 81 ALA n 1 82 LEU n 1 83 LYS n 1 84 GLU n 1 85 ARG n 1 86 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'SF3A1, SAP114' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'B21 (DE3) GOLD MAGIC' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET11 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SF3A1_HUMAN _struct_ref.pdbx_db_accession Q15459 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHL ALKERG ; _struct_ref.pdbx_align_begin 704 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ZKH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 86 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q15459 _struct_ref_seq.db_align_beg 704 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 789 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 86 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '300 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '2mM protein, U-15N, U-13C; 300 mM NaCl, 1mM benzamidine, 10mM DTT, 0.01% NaN3, 10mM Sodium Acetate, 0.01mM ZnSO4, 90%H2O, 10%D2O' '90% H2O/10% D2O' 2 '2mM protein, U-15N, U-13C; 300 mM NaCl, 1mM benzamidine, 10mM DTT, 0.01% NaN3, 10mM Sodium Acetate, 0.01mM ZnSO4, 99.9% D2O' '99.9% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 Avance Bruker 500 ? 2 Avance Bruker 600 ? # _pdbx_nmr_refine.entry_id 1ZKH _pdbx_nmr_refine.method ;100 structures were calculated by CYANA 2.0 using 2667 NOE-derived distance constraints, 121 dihedral angle constraints, and 50 distance constraints from hydrogen bonds. The 20 structures with lowest target functions were subjected to refinement with CNS 1.1. ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1ZKH _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1ZKH _pdbx_nmr_representative.conformer_id 11 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XWINNMR 3.6 'Bruker Biospin, Inc.' 1 processing NMRPipe 2.1 'Delaglio, F.' 2 'structure solution' CYANA 2.0 'Guentert, P. et al.' 3 refinement CNS 1.1 'Brunger, A. et al.' 4 # _exptl.entry_id 1ZKH _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1ZKH _struct.title 'Solution structure of a human ubiquitin-like domain in SF3A1' _struct.pdbx_descriptor 'Splicing factor 3 subunit 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ZKH _struct_keywords.pdbx_keywords 'GENE REGULATION' _struct_keywords.text 'UBIQUITIN, SPLICING FACTOR, Structural Genomics, Structural Genomics Consortium, SGC, GENE REGULATION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 33 ? THR A 45 ? GLN A 33 THR A 45 1 ? 13 HELX_P HELX_P2 2 SER A 66 ? ASN A 71 ? SER A 66 ASN A 71 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 23 ? LEU A 28 ? VAL A 23 LEU A 28 A 2 VAL A 2 ? GLN A 7 ? VAL A 2 GLN A 7 A 3 ALA A 76 ? LEU A 82 ? ALA A 76 LEU A 82 A 4 GLN A 52 ? TYR A 56 ? GLN A 52 TYR A 56 A 5 ILE A 59 ? ILE A 61 ? ILE A 59 ILE A 61 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 26 ? O PHE A 26 N ILE A 4 ? N ILE A 4 A 2 3 N GLN A 7 ? N GLN A 7 O ILE A 78 ? O ILE A 78 A 3 4 O HIS A 79 ? O HIS A 79 N GLN A 55 ? N GLN A 55 A 4 5 N TYR A 56 ? N TYR A 56 O ILE A 59 ? O ILE A 59 # _database_PDB_matrix.entry_id 1ZKH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ZKH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 1 PRO PRO A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 TRP 17 17 17 TRP TRP A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 GLY 86 86 86 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Structural Genomics Consortium' _pdbx_SG_project.initial_of_center SGC # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-05-10 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 10 OD1 A ASP 13 ? ? HZ1 A LYS 14 ? ? 1.57 2 13 HA A LYS 51 ? ? HD2 A LYS 83 ? ? 1.32 3 14 HA A LYS 51 ? ? HD2 A LYS 83 ? ? 1.27 4 18 HD11 A LEU 28 ? ? HZ3 A LYS 40 ? ? 1.34 5 19 HZ2 A TRP 17 ? ? HZ3 A LYS 51 ? ? 1.30 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 60 ? ? -68.49 94.31 2 1 MET A 72 ? ? -69.96 87.46 3 2 MET A 72 ? ? -64.27 93.28 4 3 ASN A 20 ? ? -146.96 10.10 5 3 MET A 72 ? ? -69.18 84.89 6 4 MET A 72 ? ? -67.24 89.45 7 4 ALA A 73 ? ? -77.06 -169.65 8 5 ASN A 20 ? ? -143.41 11.84 9 5 MET A 72 ? ? -63.75 90.29 10 6 MET A 72 ? ? -68.01 86.30 11 7 LYS A 18 ? ? -94.88 30.79 12 7 MET A 72 ? ? -66.05 82.44 13 8 ASN A 20 ? ? -142.27 15.67 14 8 MET A 72 ? ? -59.72 97.13 15 8 GLU A 84 ? ? -179.94 140.83 16 9 LYS A 18 ? ? -78.84 26.82 17 9 ASN A 20 ? ? -140.99 15.74 18 9 MET A 72 ? ? -65.27 88.14 19 10 MET A 72 ? ? -67.24 84.73 20 10 GLU A 84 ? ? -149.42 -153.09 21 10 ARG A 85 ? ? -109.41 -63.09 22 11 LYS A 18 ? ? -84.93 31.64 23 11 MET A 72 ? ? -67.16 92.83 24 11 GLU A 84 ? ? -173.05 138.17 25 12 LYS A 18 ? ? -88.82 30.46 26 12 MET A 72 ? ? -65.09 85.40 27 12 ARG A 85 ? ? -154.94 -58.04 28 13 MET A 72 ? ? -63.78 92.31 29 13 GLU A 84 ? ? -165.01 119.96 30 13 ARG A 85 ? ? -167.02 93.86 31 14 ASN A 20 ? ? -142.43 14.38 32 14 MET A 72 ? ? -63.01 87.69 33 15 LYS A 18 ? ? -89.35 30.64 34 15 ASN A 20 ? ? -143.12 15.84 35 15 PHE A 60 ? ? -68.62 92.75 36 15 MET A 72 ? ? -67.96 88.03 37 15 LYS A 83 ? ? -49.70 107.40 38 15 ARG A 85 ? ? 67.00 -73.72 39 17 MET A 72 ? ? -67.48 87.13 40 17 LYS A 83 ? ? -58.10 -179.75 41 18 MET A 72 ? ? -62.80 94.27 42 18 ARG A 85 ? ? -138.43 -31.87 43 19 MET A 72 ? ? -62.04 87.79 44 19 ARG A 85 ? ? -148.78 29.72 45 20 LYS A 18 ? ? -81.96 31.43 46 20 ASN A 20 ? ? -147.29 19.27 47 20 MET A 72 ? ? -69.08 90.09 #