data_1ZRM # _entry.id 1ZRM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ZRM pdb_00001zrm 10.2210/pdb1zrm/pdb WWPDB D_1000177529 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ZRM _pdbx_database_status.recvd_initial_deposition_date 1998-03-03 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Li, Y.-F.' 1 'Hata, Y.' 2 'Fujii, T.' 3 'Hisano, T.' 4 'Nishihara, M.' 5 'Kurihara, T.' 6 'Esaki, N.' 7 # _citation.id primary _citation.title 'Crystal structures of reaction intermediates of L-2-haloacid dehalogenase and implications for the reaction mechanism.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 273 _citation.page_first 15035 _citation.page_last 15044 _citation.year 1998 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9614112 _citation.pdbx_database_id_DOI 10.1074/jbc.273.24.15035 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, Y.F.' 1 ? primary 'Hata, Y.' 2 ? primary 'Fujii, T.' 3 ? primary 'Hisano, T.' 4 ? primary 'Nishihara, M.' 5 ? primary 'Kurihara, T.' 6 ? primary 'Esaki, N.' 7 ? # _cell.entry_id 1ZRM _cell.length_a 90.990 _cell.length_b 62.940 _cell.length_c 50.950 _cell.angle_alpha 90.00 _cell.angle_beta 122.70 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ZRM _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'L-2-HALOACID DEHALOGENASE' 26191.588 1 3.8.1.2 S175A ? ? 2 non-polymer syn 'butanoic acid' 88.105 1 ? ? ? ? 3 water nat water 18.015 51 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDYIKGIAFDLYGTLFDVHSVVGRCDEAFPGRGREISALWRQKQLEYTWLRSLMNRYVNFQQATEDALRFTCRHLGLDLD ARTRSTLCDAYLRLAPFSEVPDSLRELKRRGLKLAILSNGSPQSIDAVVSHAGLRDGFDHLLSVDPVQVYKPDNRVYELA EQALGLDRSAILFVASNAWDATGARYFGFPTCWINRTGNVFEEMGQTPDWEVTSLRAVVELFETAAGKAEKG ; _entity_poly.pdbx_seq_one_letter_code_can ;MDYIKGIAFDLYGTLFDVHSVVGRCDEAFPGRGREISALWRQKQLEYTWLRSLMNRYVNFQQATEDALRFTCRHLGLDLD ARTRSTLCDAYLRLAPFSEVPDSLRELKRRGLKLAILSNGSPQSIDAVVSHAGLRDGFDHLLSVDPVQVYKPDNRVYELA EQALGLDRSAILFVASNAWDATGARYFGFPTCWINRTGNVFEEMGQTPDWEVTSLRAVVELFETAAGKAEKG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 TYR n 1 4 ILE n 1 5 LYS n 1 6 GLY n 1 7 ILE n 1 8 ALA n 1 9 PHE n 1 10 ASP n 1 11 LEU n 1 12 TYR n 1 13 GLY n 1 14 THR n 1 15 LEU n 1 16 PHE n 1 17 ASP n 1 18 VAL n 1 19 HIS n 1 20 SER n 1 21 VAL n 1 22 VAL n 1 23 GLY n 1 24 ARG n 1 25 CYS n 1 26 ASP n 1 27 GLU n 1 28 ALA n 1 29 PHE n 1 30 PRO n 1 31 GLY n 1 32 ARG n 1 33 GLY n 1 34 ARG n 1 35 GLU n 1 36 ILE n 1 37 SER n 1 38 ALA n 1 39 LEU n 1 40 TRP n 1 41 ARG n 1 42 GLN n 1 43 LYS n 1 44 GLN n 1 45 LEU n 1 46 GLU n 1 47 TYR n 1 48 THR n 1 49 TRP n 1 50 LEU n 1 51 ARG n 1 52 SER n 1 53 LEU n 1 54 MET n 1 55 ASN n 1 56 ARG n 1 57 TYR n 1 58 VAL n 1 59 ASN n 1 60 PHE n 1 61 GLN n 1 62 GLN n 1 63 ALA n 1 64 THR n 1 65 GLU n 1 66 ASP n 1 67 ALA n 1 68 LEU n 1 69 ARG n 1 70 PHE n 1 71 THR n 1 72 CYS n 1 73 ARG n 1 74 HIS n 1 75 LEU n 1 76 GLY n 1 77 LEU n 1 78 ASP n 1 79 LEU n 1 80 ASP n 1 81 ALA n 1 82 ARG n 1 83 THR n 1 84 ARG n 1 85 SER n 1 86 THR n 1 87 LEU n 1 88 CYS n 1 89 ASP n 1 90 ALA n 1 91 TYR n 1 92 LEU n 1 93 ARG n 1 94 LEU n 1 95 ALA n 1 96 PRO n 1 97 PHE n 1 98 SER n 1 99 GLU n 1 100 VAL n 1 101 PRO n 1 102 ASP n 1 103 SER n 1 104 LEU n 1 105 ARG n 1 106 GLU n 1 107 LEU n 1 108 LYS n 1 109 ARG n 1 110 ARG n 1 111 GLY n 1 112 LEU n 1 113 LYS n 1 114 LEU n 1 115 ALA n 1 116 ILE n 1 117 LEU n 1 118 SER n 1 119 ASN n 1 120 GLY n 1 121 SER n 1 122 PRO n 1 123 GLN n 1 124 SER n 1 125 ILE n 1 126 ASP n 1 127 ALA n 1 128 VAL n 1 129 VAL n 1 130 SER n 1 131 HIS n 1 132 ALA n 1 133 GLY n 1 134 LEU n 1 135 ARG n 1 136 ASP n 1 137 GLY n 1 138 PHE n 1 139 ASP n 1 140 HIS n 1 141 LEU n 1 142 LEU n 1 143 SER n 1 144 VAL n 1 145 ASP n 1 146 PRO n 1 147 VAL n 1 148 GLN n 1 149 VAL n 1 150 TYR n 1 151 LYS n 1 152 PRO n 1 153 ASP n 1 154 ASN n 1 155 ARG n 1 156 VAL n 1 157 TYR n 1 158 GLU n 1 159 LEU n 1 160 ALA n 1 161 GLU n 1 162 GLN n 1 163 ALA n 1 164 LEU n 1 165 GLY n 1 166 LEU n 1 167 ASP n 1 168 ARG n 1 169 SER n 1 170 ALA n 1 171 ILE n 1 172 LEU n 1 173 PHE n 1 174 VAL n 1 175 ALA n 1 176 SER n 1 177 ASN n 1 178 ALA n 1 179 TRP n 1 180 ASP n 1 181 ALA n 1 182 THR n 1 183 GLY n 1 184 ALA n 1 185 ARG n 1 186 TYR n 1 187 PHE n 1 188 GLY n 1 189 PHE n 1 190 PRO n 1 191 THR n 1 192 CYS n 1 193 TRP n 1 194 ILE n 1 195 ASN n 1 196 ARG n 1 197 THR n 1 198 GLY n 1 199 ASN n 1 200 VAL n 1 201 PHE n 1 202 GLU n 1 203 GLU n 1 204 MET n 1 205 GLY n 1 206 GLN n 1 207 THR n 1 208 PRO n 1 209 ASP n 1 210 TRP n 1 211 GLU n 1 212 VAL n 1 213 THR n 1 214 SER n 1 215 LEU n 1 216 ARG n 1 217 ALA n 1 218 VAL n 1 219 VAL n 1 220 GLU n 1 221 LEU n 1 222 PHE n 1 223 GLU n 1 224 THR n 1 225 ALA n 1 226 ALA n 1 227 GLY n 1 228 LYS n 1 229 ALA n 1 230 GLU n 1 231 LYS n 1 232 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene L-DEX_YL _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain YL _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas sp.' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 66693 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene L-DEX_YL _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain JM109 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PUC119 _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PBA501 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HAD_PSEUY _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q53464 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MDYIKGIAFDLYGTLFDVHSVVGRCDEAFPGRGREISALWRQKQLEYTWLRSLMNRYVNFQQATEDALRFTCRHLGLDLD ARTRSTLCDAYLRLAPFSEVPDSLRELKRRGLKLAILSNGSPQSIDAVVSHAGLRDGFDHLLSVDPVQVYKPDNRVYELA EQALGLDRSAILFVSSNAWDATGARYFGFPTCWINRTGNVFEEMGQTPDWEVTSLRAVVELFETAAGKAEKG ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ZRM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 232 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q53464 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 232 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 232 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1ZRM _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 175 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q53464 _struct_ref_seq_dif.db_mon_id SER _struct_ref_seq_dif.pdbx_seq_db_seq_num 175 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 175 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BUA non-polymer . 'butanoic acid' ? 'C4 H8 O2' 88.105 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1ZRM _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.35 _exptl_crystal.density_percent_sol 48.0 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 5.5' # _diffrn.id 1 _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IIC' _diffrn_detector.pdbx_collection_date 1997-06-26 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'GRAPHITE(002)' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source ? _diffrn_source.type ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1ZRM _reflns.observed_criterion_sigma_I 1.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 48.62 _reflns.d_resolution_high 1.78 _reflns.number_obs 14454 _reflns.number_all ? _reflns.percent_possible_obs 87.1 _reflns.pdbx_Rmerge_I_obs 0.0830000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 19.92 _reflns.pdbx_redundancy 2.58 _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.78 _reflns_shell.d_res_low 2.00 _reflns_shell.percent_possible_all 74.9 _reflns_shell.Rmerge_I_obs 0.3340000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 2.78 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1ZRM _refine.ls_number_reflns_obs 12280 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF 100000.00 _refine.pdbx_data_cutoff_low_absF 0.1000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 8.0 _refine.ls_d_res_high 2.0 _refine.ls_percent_reflns_obs 75.9 _refine.ls_R_factor_obs 0.2040000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2040000 _refine.ls_R_factor_R_free 0.2870000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.4 _refine.ls_number_reflns_R_free 1273 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 42.16 _refine.aniso_B[1][1] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[3][3] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 1JUD _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1ZRM _refine_analyze.Luzzati_coordinate_error_obs 0.38 _refine_analyze.Luzzati_sigma_a_obs 0.49 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.44 _refine_analyze.Luzzati_sigma_a_free 0.58 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1746 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 51 _refine_hist.number_atoms_total 1803 _refine_hist.d_res_high 2.0 _refine_hist.d_res_low 8.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.24 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 22.6 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.04 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.d_res_high 2.00 _refine_ls_shell.d_res_low 2.09 _refine_ls_shell.number_reflns_R_work 702 _refine_ls_shell.R_factor_R_work 0.3900000 _refine_ls_shell.percent_reflns_obs 38.5 _refine_ls_shell.R_factor_R_free 0.4660000 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free 9.83 _refine_ls_shell.number_reflns_R_free 69 _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 2 PARA.WATER TOPO.WATER 'X-RAY DIFFRACTION' 3 PARA.CPD TOPO.CPD 'X-RAY DIFFRACTION' # _struct.entry_id 1ZRM _struct.title 'CRYSTAL STRUCTURE OF THE REACTION INTERMEDIATE OF L-2-HALOACID DEHALOGENASE WITH 2-CHLORO-N-BUTYRATE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ZRM _struct_keywords.pdbx_keywords DEHALOGENASE _struct_keywords.text 'DEHALOGENASE, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 18 ? ALA A 28 ? VAL A 18 ALA A 28 5 ? 11 HELX_P HELX_P2 2 GLY A 33 ? LEU A 53 ? GLY A 33 LEU A 53 1 ? 21 HELX_P HELX_P3 3 PHE A 60 ? LEU A 75 ? PHE A 60 LEU A 75 1 ? 16 HELX_P HELX_P4 4 ALA A 81 ? ARG A 93 ? ALA A 81 ARG A 93 1 ? 13 HELX_P HELX_P5 5 VAL A 100 ? ARG A 109 ? VAL A 100 ARG A 109 1 ? 10 HELX_P HELX_P6 6 PRO A 122 ? HIS A 131 ? PRO A 122 HIS A 131 1 ? 10 HELX_P HELX_P7 7 ARG A 135 ? GLY A 137 ? ARG A 135 GLY A 137 5 ? 3 HELX_P HELX_P8 8 VAL A 144 ? VAL A 147 ? VAL A 144 VAL A 147 5 ? 4 HELX_P HELX_P9 9 ASN A 154 ? LEU A 164 ? ASN A 154 LEU A 164 1 ? 11 HELX_P HELX_P10 10 ARG A 168 ? ALA A 170 ? ARG A 168 ALA A 170 5 ? 3 HELX_P HELX_P11 11 ALA A 178 ? PHE A 187 ? ALA A 178 PHE A 187 1 ? 10 HELX_P HELX_P12 12 LEU A 215 ? VAL A 219 ? LEU A 215 VAL A 219 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id ASP _struct_conn.ptnr1_label_seq_id 10 _struct_conn.ptnr1_label_atom_id OD1 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id BUA _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C2 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id ASP _struct_conn.ptnr1_auth_seq_id 10 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id BUA _struct_conn.ptnr2_auth_seq_id 300 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.409 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 151 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 151 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 152 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 152 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.34 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 210 ? VAL A 212 ? TRP A 210 VAL A 212 A 2 PRO A 190 ? ILE A 194 ? PRO A 190 ILE A 194 A 3 ILE A 171 ? ALA A 175 ? ILE A 171 ALA A 175 A 4 GLY A 6 ? PHE A 9 ? GLY A 6 PHE A 9 A 5 LYS A 113 ? SER A 118 ? LYS A 113 SER A 118 A 6 HIS A 140 ? SER A 143 ? HIS A 140 SER A 143 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TRP A 210 ? O TRP A 210 N TRP A 193 ? N TRP A 193 A 2 3 O PRO A 190 ? O PRO A 190 N PHE A 173 ? N PHE A 173 A 3 4 O LEU A 172 ? O LEU A 172 N GLY A 6 ? N GLY A 6 A 4 5 O ILE A 7 ? O ILE A 7 N LYS A 113 ? N LYS A 113 A 5 6 O ILE A 116 ? O ILE A 116 N HIS A 140 ? N HIS A 140 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id BUA _struct_site.pdbx_auth_seq_id 300 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 7 _struct_site.details 'BINDING SITE FOR RESIDUE BUA A 300' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 ASP A 10 ? ASP A 10 . ? 1_555 ? 2 AC1 7 LEU A 11 ? LEU A 11 . ? 1_555 ? 3 AC1 7 TYR A 12 ? TYR A 12 . ? 1_555 ? 4 AC1 7 SER A 118 ? SER A 118 . ? 1_555 ? 5 AC1 7 ASN A 119 ? ASN A 119 . ? 1_555 ? 6 AC1 7 LYS A 151 ? LYS A 151 . ? 1_555 ? 7 AC1 7 ASN A 177 ? ASN A 177 . ? 1_555 ? # _database_PDB_matrix.entry_id 1ZRM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ZRM _atom_sites.fract_transf_matrix[1][1] 0.010990 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.007056 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015888 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023324 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASP 2 2 ? ? ? A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 TRP 49 49 49 TRP TRP A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 MET 54 54 54 MET MET A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 CYS 88 88 88 CYS CYS A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 PRO 122 122 122 PRO PRO A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 HIS 140 140 140 HIS HIS A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 GLN 148 148 148 GLN GLN A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 PRO 152 152 152 PRO PRO A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 GLN 162 162 162 GLN GLN A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 ARG 168 168 168 ARG ARG A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 PHE 173 173 173 PHE PHE A . n A 1 174 VAL 174 174 174 VAL VAL A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 SER 176 176 176 SER SER A . n A 1 177 ASN 177 177 177 ASN ASN A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 TRP 179 179 179 TRP TRP A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 GLY 183 183 183 GLY GLY A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 ARG 185 185 185 ARG ARG A . n A 1 186 TYR 186 186 186 TYR TYR A . n A 1 187 PHE 187 187 187 PHE PHE A . n A 1 188 GLY 188 188 188 GLY GLY A . n A 1 189 PHE 189 189 189 PHE PHE A . n A 1 190 PRO 190 190 190 PRO PRO A . n A 1 191 THR 191 191 191 THR THR A . n A 1 192 CYS 192 192 192 CYS CYS A . n A 1 193 TRP 193 193 193 TRP TRP A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 ASN 195 195 195 ASN ASN A . n A 1 196 ARG 196 196 196 ARG ARG A . n A 1 197 THR 197 197 197 THR THR A . n A 1 198 GLY 198 198 198 GLY GLY A . n A 1 199 ASN 199 199 199 ASN ASN A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 PHE 201 201 201 PHE PHE A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 MET 204 204 204 MET MET A . n A 1 205 GLY 205 205 205 GLY GLY A . n A 1 206 GLN 206 206 206 GLN GLN A . n A 1 207 THR 207 207 207 THR THR A . n A 1 208 PRO 208 208 208 PRO PRO A . n A 1 209 ASP 209 209 209 ASP ASP A . n A 1 210 TRP 210 210 210 TRP TRP A . n A 1 211 GLU 211 211 211 GLU GLU A . n A 1 212 VAL 212 212 212 VAL VAL A . n A 1 213 THR 213 213 213 THR THR A . n A 1 214 SER 214 214 214 SER SER A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 ARG 216 216 216 ARG ARG A . n A 1 217 ALA 217 217 217 ALA ALA A . n A 1 218 VAL 218 218 218 VAL VAL A . n A 1 219 VAL 219 219 219 VAL VAL A . n A 1 220 GLU 220 220 220 GLU GLU A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 PHE 222 222 222 PHE PHE A . n A 1 223 GLU 223 223 ? ? ? A . n A 1 224 THR 224 224 ? ? ? A . n A 1 225 ALA 225 225 ? ? ? A . n A 1 226 ALA 226 226 ? ? ? A . n A 1 227 GLY 227 227 ? ? ? A . n A 1 228 LYS 228 228 ? ? ? A . n A 1 229 ALA 229 229 ? ? ? A . n A 1 230 GLU 230 230 ? ? ? A . n A 1 231 LYS 231 231 ? ? ? A . n A 1 232 GLY 232 232 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BUA 1 300 300 BUA BUA A . C 3 HOH 1 500 500 HOH HOH A . C 3 HOH 2 501 501 HOH HOH A . C 3 HOH 3 502 502 HOH HOH A . C 3 HOH 4 503 503 HOH HOH A . C 3 HOH 5 504 504 HOH HOH A . C 3 HOH 6 505 505 HOH HOH A . C 3 HOH 7 506 506 HOH HOH A . C 3 HOH 8 507 507 HOH HOH A . C 3 HOH 9 508 508 HOH HOH A . C 3 HOH 10 509 509 HOH HOH A . C 3 HOH 11 510 510 HOH HOH A . C 3 HOH 12 511 511 HOH HOH A . C 3 HOH 13 512 512 HOH HOH A . C 3 HOH 14 513 513 HOH HOH A . C 3 HOH 15 514 514 HOH HOH A . C 3 HOH 16 515 515 HOH HOH A . C 3 HOH 17 516 516 HOH HOH A . C 3 HOH 18 517 517 HOH HOH A . C 3 HOH 19 518 518 HOH HOH A . C 3 HOH 20 519 519 HOH HOH A . C 3 HOH 21 520 520 HOH HOH A . C 3 HOH 22 521 521 HOH HOH A . C 3 HOH 23 522 522 HOH HOH A . C 3 HOH 24 523 523 HOH HOH A . C 3 HOH 25 524 524 HOH HOH A . C 3 HOH 26 525 525 HOH HOH A . C 3 HOH 27 526 526 HOH HOH A . C 3 HOH 28 527 527 HOH HOH A . C 3 HOH 29 528 528 HOH HOH A . C 3 HOH 30 529 529 HOH HOH A . C 3 HOH 31 530 530 HOH HOH A . C 3 HOH 32 531 531 HOH HOH A . C 3 HOH 33 532 532 HOH HOH A . C 3 HOH 34 533 533 HOH HOH A . C 3 HOH 35 534 534 HOH HOH A . C 3 HOH 36 535 535 HOH HOH A . C 3 HOH 37 536 536 HOH HOH A . C 3 HOH 38 537 537 HOH HOH A . C 3 HOH 39 538 538 HOH HOH A . C 3 HOH 40 539 539 HOH HOH A . C 3 HOH 41 540 540 HOH HOH A . C 3 HOH 42 541 541 HOH HOH A . C 3 HOH 43 542 542 HOH HOH A . C 3 HOH 44 543 543 HOH HOH A . C 3 HOH 45 544 544 HOH HOH A . C 3 HOH 46 545 545 HOH HOH A . C 3 HOH 47 546 546 HOH HOH A . C 3 HOH 48 547 547 HOH HOH A . C 3 HOH 49 548 548 HOH HOH A . C 3 HOH 50 549 549 HOH HOH A . C 3 HOH 51 550 550 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3330 ? 1 MORE -10 ? 1 'SSA (A^2)' 17400 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 63.4647556717 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 42.8749743401 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-03-23 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-03-14 5 'Structure model' 1 4 2023-05-31 6 'Structure model' 1 5 2023-08-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Source and taxonomy' 4 3 'Structure model' 'Version format compliance' 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Derived calculations' 9 5 'Structure model' 'Structure summary' 10 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' struct_ref_seq_dif 3 5 'Structure model' chem_comp 4 5 'Structure model' database_2 5 5 'Structure model' entity 6 5 'Structure model' pdbx_entity_nonpoly 7 5 'Structure model' struct_conn 8 5 'Structure model' struct_ref_seq_dif 9 5 'Structure model' struct_site 10 6 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 4 'Structure model' '_struct_ref_seq_dif.details' 3 5 'Structure model' '_chem_comp.name' 4 5 'Structure model' '_database_2.pdbx_DOI' 5 5 'Structure model' '_database_2.pdbx_database_accession' 6 5 'Structure model' '_entity.pdbx_description' 7 5 'Structure model' '_pdbx_entity_nonpoly.name' 8 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 9 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 10 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 11 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 12 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 13 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 14 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 15 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 16 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 17 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 18 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 19 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 20 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 21 5 'Structure model' '_struct_ref_seq_dif.details' 22 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 23 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 24 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 R-AXIS 'data reduction' IIC ? 3 R-AXIS 'data scaling' IIC ? 4 X-PLOR phasing 3.1 ? 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASP 10 ? ? C3 A BUA 300 ? ? 1.44 2 1 O A HOH 514 ? ? O A HOH 544 ? ? 2.18 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 NH1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ARG _pdbx_validate_symm_contact.auth_seq_id_1 82 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NE2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 GLN _pdbx_validate_symm_contact.auth_seq_id_2 162 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_556 _pdbx_validate_symm_contact.dist 2.17 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 10 ? ? CG A ASP 10 ? ? OD1 A ASP 10 ? ? 108.53 118.30 -9.77 0.90 N 2 1 CB A ASP 10 ? ? CG A ASP 10 ? ? OD2 A ASP 10 ? ? 124.35 118.30 6.05 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 11 ? ? -87.17 -73.80 2 1 ARG A 56 ? ? -119.54 76.17 3 1 PRO A 152 ? ? -90.43 33.99 4 1 GLU A 203 ? ? -94.47 59.65 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A TYR 3 ? CG ? A TYR 3 CG 2 1 Y 1 A TYR 3 ? CD1 ? A TYR 3 CD1 3 1 Y 1 A TYR 3 ? CD2 ? A TYR 3 CD2 4 1 Y 1 A TYR 3 ? CE1 ? A TYR 3 CE1 5 1 Y 1 A TYR 3 ? CE2 ? A TYR 3 CE2 6 1 Y 1 A TYR 3 ? CZ ? A TYR 3 CZ 7 1 Y 1 A TYR 3 ? OH ? A TYR 3 OH 8 1 Y 1 A ARG 109 ? CG ? A ARG 109 CG 9 1 Y 1 A ARG 109 ? CD ? A ARG 109 CD 10 1 Y 1 A ARG 109 ? NE ? A ARG 109 NE 11 1 Y 1 A ARG 109 ? CZ ? A ARG 109 CZ 12 1 Y 1 A ARG 109 ? NH1 ? A ARG 109 NH1 13 1 Y 1 A ARG 109 ? NH2 ? A ARG 109 NH2 14 1 Y 1 A GLU 220 ? CG ? A GLU 220 CG 15 1 Y 1 A GLU 220 ? CD ? A GLU 220 CD 16 1 Y 1 A GLU 220 ? OE1 ? A GLU 220 OE1 17 1 Y 1 A GLU 220 ? OE2 ? A GLU 220 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASP 2 ? A ASP 2 3 1 Y 1 A GLU 223 ? A GLU 223 4 1 Y 1 A THR 224 ? A THR 224 5 1 Y 1 A ALA 225 ? A ALA 225 6 1 Y 1 A ALA 226 ? A ALA 226 7 1 Y 1 A GLY 227 ? A GLY 227 8 1 Y 1 A LYS 228 ? A LYS 228 9 1 Y 1 A ALA 229 ? A ALA 229 10 1 Y 1 A GLU 230 ? A GLU 230 11 1 Y 1 A LYS 231 ? A LYS 231 12 1 Y 1 A GLY 232 ? A GLY 232 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'butanoic acid' BUA 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1JUD _pdbx_initial_refinement_model.details ? #