data_1ZWE # _entry.id 1ZWE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ZWE pdb_00001zwe 10.2210/pdb1zwe/pdb WWPDB D_1000177543 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ZWE _pdbx_database_status.recvd_initial_deposition_date 1996-06-17 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Roesch, P.' 1 'Marx, U.C.' 2 # _citation.id primary _citation.title 'Structure-activity relation of NH2-terminal human parathyroid hormone fragments.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 273 _citation.page_first 4308 _citation.page_last 4316 _citation.year 1998 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9468478 _citation.pdbx_database_id_DOI 10.1074/jbc.273.8.4308 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Marx, U.C.' 1 ? primary 'Adermann, K.' 2 ? primary 'Bayer, P.' 3 ? primary 'Meyer, M.' 4 ? primary 'Forssmann, W.G.' 5 ? primary 'Rosch, P.' 6 ? # _cell.entry_id 1ZWE _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ZWE _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PARATHYROID HORMONE' _entity.formula_weight 4135.857 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment '4 - 37' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HPTH(4-37)' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code EIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL _entity_poly.pdbx_seq_one_letter_code_can EIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 ILE n 1 3 GLN n 1 4 LEU n 1 5 MET n 1 6 HIS n 1 7 ASN n 1 8 LEU n 1 9 GLY n 1 10 LYS n 1 11 HIS n 1 12 LEU n 1 13 ASN n 1 14 SER n 1 15 MET n 1 16 GLU n 1 17 ARG n 1 18 VAL n 1 19 GLU n 1 20 TRP n 1 21 LEU n 1 22 ARG n 1 23 LYS n 1 24 LYS n 1 25 LEU n 1 26 GLN n 1 27 ASP n 1 28 VAL n 1 29 HIS n 1 30 ASN n 1 31 PHE n 1 32 VAL n 1 33 ALA n 1 34 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene POTENTIAL _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTHY_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P01270 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQ RPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ZWE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 34 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01270 _struct_ref_seq.db_align_beg 35 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 68 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 34 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1ZWE _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version 3.1 _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1ZWE _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1ZWE _struct.title 'STRUCTURE OF HUMAN PARATHYROID HORMONE FRAGMENT 4-37, NMR, 10 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ZWE _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text 'HORMONE, DISEASE MUTATION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id MET _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 15 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 25 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id MET _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 15 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 25 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1ZWE _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ZWE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 LEU 34 34 34 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-03-12 2 'Structure model' 1 1 2008-03-21 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 6 O A ARG 17 ? ? H A LEU 21 ? ? 1.60 2 9 O A ARG 17 ? ? H A LEU 21 ? ? 1.55 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 4 ? ? -146.37 40.51 2 1 LYS A 10 ? ? 72.41 -73.31 3 1 ASN A 30 ? ? 70.20 153.15 4 2 LEU A 4 ? ? -106.71 64.07 5 2 ASN A 7 ? ? -145.38 36.37 6 2 HIS A 11 ? ? 80.36 -138.59 7 2 LEU A 12 ? ? 73.91 129.51 8 2 SER A 14 ? ? 173.78 -64.93 9 2 ASN A 30 ? ? 67.88 165.27 10 2 VAL A 32 ? ? -105.79 59.38 11 3 LEU A 4 ? ? 73.28 -66.08 12 3 ASN A 7 ? ? 80.99 -18.03 13 3 LEU A 8 ? ? 68.36 -72.46 14 3 LYS A 10 ? ? -98.31 47.97 15 3 HIS A 11 ? ? -173.71 132.36 16 3 LEU A 12 ? ? 175.58 142.43 17 3 GLU A 16 ? ? -93.01 49.03 18 3 ARG A 17 ? ? -147.07 -55.47 19 3 LYS A 23 ? ? -84.54 -94.83 20 3 ASP A 27 ? ? 37.76 33.33 21 4 ILE A 2 ? ? 68.23 110.70 22 4 MET A 5 ? ? -148.95 49.16 23 4 HIS A 6 ? ? 59.67 90.97 24 4 LEU A 8 ? ? 64.93 -83.54 25 4 LYS A 10 ? ? 68.41 -80.35 26 4 ASN A 13 ? ? -161.33 -52.16 27 4 SER A 14 ? ? -124.41 -80.22 28 4 VAL A 18 ? ? -133.93 -49.06 29 4 PHE A 31 ? ? -154.10 -60.76 30 4 VAL A 32 ? ? 61.52 72.39 31 5 ASN A 7 ? ? 64.20 -93.62 32 5 HIS A 11 ? ? 69.59 106.73 33 5 ASN A 13 ? ? -153.71 -64.32 34 5 SER A 14 ? ? -163.94 -61.46 35 5 HIS A 29 ? ? 64.10 65.34 36 6 ILE A 2 ? ? 66.35 103.19 37 6 HIS A 6 ? ? 60.12 73.16 38 6 LYS A 10 ? ? 63.49 60.34 39 6 ASN A 13 ? ? -149.57 -65.01 40 6 SER A 14 ? ? -148.02 -65.77 41 6 PHE A 31 ? ? -146.53 36.29 42 7 ILE A 2 ? ? 45.45 -153.59 43 7 GLN A 3 ? ? 60.55 81.36 44 7 ASN A 7 ? ? 75.01 -68.59 45 7 HIS A 11 ? ? -154.17 22.34 46 7 ARG A 22 ? ? 176.28 -51.03 47 7 LEU A 25 ? ? -173.69 -57.75 48 7 VAL A 28 ? ? 74.91 72.72 49 7 PHE A 31 ? ? -171.62 109.17 50 8 LYS A 10 ? ? -100.47 51.89 51 8 LEU A 12 ? ? 65.11 -150.18 52 8 ASN A 13 ? ? -129.73 -69.79 53 8 SER A 14 ? ? -147.00 -74.24 54 8 LEU A 25 ? ? 84.58 -49.17 55 8 ASP A 27 ? ? -90.85 -60.50 56 9 ILE A 2 ? ? -105.18 56.57 57 9 GLN A 3 ? ? -167.61 96.99 58 9 HIS A 6 ? ? -119.29 60.92 59 9 ASN A 7 ? ? -149.72 -98.90 60 9 HIS A 11 ? ? 74.24 -96.93 61 9 LEU A 12 ? ? 64.43 -174.03 62 9 ASN A 13 ? ? -132.04 -76.65 63 9 SER A 14 ? ? -150.09 -61.39 64 9 ASP A 27 ? ? -120.34 -64.66 65 10 GLN A 3 ? ? -145.40 54.15 66 10 LEU A 4 ? ? 70.10 -73.31 67 10 HIS A 6 ? ? -130.25 -59.00 68 10 LEU A 8 ? ? -161.39 80.58 69 10 ASN A 13 ? ? -140.22 -79.29 70 10 SER A 14 ? ? -122.40 -75.26 71 10 ARG A 17 ? ? -96.42 33.99 72 10 VAL A 18 ? ? -134.82 -50.58 73 10 HIS A 29 ? ? 70.70 -66.48 74 10 ASN A 30 ? ? 71.69 115.44 75 10 VAL A 32 ? ? 73.64 106.26 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 17 ? ? 0.316 'SIDE CHAIN' 2 1 ARG A 22 ? ? 0.313 'SIDE CHAIN' 3 2 ARG A 17 ? ? 0.319 'SIDE CHAIN' 4 2 ARG A 22 ? ? 0.259 'SIDE CHAIN' 5 3 ARG A 17 ? ? 0.319 'SIDE CHAIN' 6 3 ARG A 22 ? ? 0.315 'SIDE CHAIN' 7 4 ARG A 17 ? ? 0.310 'SIDE CHAIN' 8 4 ARG A 22 ? ? 0.298 'SIDE CHAIN' 9 5 ARG A 17 ? ? 0.315 'SIDE CHAIN' 10 5 ARG A 22 ? ? 0.299 'SIDE CHAIN' 11 6 ARG A 17 ? ? 0.313 'SIDE CHAIN' 12 6 ARG A 22 ? ? 0.308 'SIDE CHAIN' 13 7 ARG A 17 ? ? 0.312 'SIDE CHAIN' 14 7 ARG A 22 ? ? 0.315 'SIDE CHAIN' 15 8 ARG A 17 ? ? 0.304 'SIDE CHAIN' 16 8 ARG A 22 ? ? 0.304 'SIDE CHAIN' 17 9 ARG A 17 ? ? 0.315 'SIDE CHAIN' 18 9 ARG A 22 ? ? 0.317 'SIDE CHAIN' 19 10 ARG A 17 ? ? 0.312 'SIDE CHAIN' 20 10 ARG A 22 ? ? 0.315 'SIDE CHAIN' #