data_1A3T # _entry.id 1A3T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1A3T pdb_00001a3t 10.2210/pdb1a3t/pdb WWPDB D_1000170357 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1A3T _pdbx_database_status.recvd_initial_deposition_date 1998-01-24 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wynn, R.' 1 'Harkins, P.C.' 2 'Richards, F.M.' 3 'Fox, R.O.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Comparison of straight chain and cyclic unnatural amino acids embedded in the core of staphylococcal nuclease.' 'Protein Sci.' 6 1621 1626 1997 PRCIEI US 0961-8368 0795 ? 9260275 ? 1 'Mobile Unnatural Amino Acid Side Chains in the Core of Staphylococcal Nuclease' 'Protein Sci.' 5 1026 ? 1996 PRCIEI US 0961-8368 0795 ? ? ? 2 'Interactions in Nonnative and Truncated Forms of Staphylococcal Nuclease as Indicated by Mutational Free Energy Changes' 'Protein Sci.' 4 1815 ? 1995 PRCIEI US 0961-8368 0795 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wynn, R.' 1 ? primary 'Harkins, P.C.' 2 ? primary 'Richards, F.M.' 3 ? primary 'Fox, R.O.' 4 ? 1 'Wynn, R.' 5 ? 1 'Harkins, P.C.' 6 ? 1 'Richards, F.M.' 7 ? 1 'Fox, R.O.' 8 ? 2 'Wynn, R.' 9 ? 2 'Anderson, C.L.' 10 ? 2 'Richards, F.M.' 11 ? 2 'Fox, R.O.' 12 ? # _cell.entry_id 1A3T _cell.length_a 48.400 _cell.length_b 48.400 _cell.length_c 63.300 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1A3T _symmetry.space_group_name_H-M 'P 41' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 76 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'STAPHYLOCOCCAL NUCLEASE' 16925.451 1 3.1.31.1 'V23C, S-THIOETHYLFLUORO DISULFIDE' ? 'VARIANT FORMED BY CHEMICAL MODIFICATION OF THE SOLE CYSTEINE RESIDUE' 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 non-polymer syn "THYMIDINE-3',5'-DIPHOSPHATE" 402.188 1 ? ? ? ? 4 water nat water 18.015 38 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;ATSTKKLHKEPATLIKAIDGDT(EFC)KLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEF DKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWSEDNADSGQ ; _entity_poly.pdbx_seq_one_letter_code_can ;ATSTKKLHKEPATLIKAIDGDTCKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQ RTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWSEDNADSGQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 THR n 1 3 SER n 1 4 THR n 1 5 LYS n 1 6 LYS n 1 7 LEU n 1 8 HIS n 1 9 LYS n 1 10 GLU n 1 11 PRO n 1 12 ALA n 1 13 THR n 1 14 LEU n 1 15 ILE n 1 16 LYS n 1 17 ALA n 1 18 ILE n 1 19 ASP n 1 20 GLY n 1 21 ASP n 1 22 THR n 1 23 EFC n 1 24 LYS n 1 25 LEU n 1 26 MET n 1 27 TYR n 1 28 LYS n 1 29 GLY n 1 30 GLN n 1 31 PRO n 1 32 MET n 1 33 THR n 1 34 PHE n 1 35 ARG n 1 36 LEU n 1 37 LEU n 1 38 LEU n 1 39 VAL n 1 40 ASP n 1 41 THR n 1 42 PRO n 1 43 GLU n 1 44 THR n 1 45 LYS n 1 46 HIS n 1 47 PRO n 1 48 LYS n 1 49 LYS n 1 50 GLY n 1 51 VAL n 1 52 GLU n 1 53 LYS n 1 54 TYR n 1 55 GLY n 1 56 PRO n 1 57 GLU n 1 58 ALA n 1 59 SER n 1 60 ALA n 1 61 PHE n 1 62 THR n 1 63 LYS n 1 64 LYS n 1 65 MET n 1 66 VAL n 1 67 GLU n 1 68 ASN n 1 69 ALA n 1 70 LYS n 1 71 LYS n 1 72 ILE n 1 73 GLU n 1 74 VAL n 1 75 GLU n 1 76 PHE n 1 77 ASP n 1 78 LYS n 1 79 GLY n 1 80 GLN n 1 81 ARG n 1 82 THR n 1 83 ASP n 1 84 LYS n 1 85 TYR n 1 86 GLY n 1 87 ARG n 1 88 GLY n 1 89 LEU n 1 90 ALA n 1 91 TYR n 1 92 ILE n 1 93 TYR n 1 94 ALA n 1 95 ASP n 1 96 GLY n 1 97 LYS n 1 98 MET n 1 99 VAL n 1 100 ASN n 1 101 GLU n 1 102 ALA n 1 103 LEU n 1 104 VAL n 1 105 ARG n 1 106 GLN n 1 107 GLY n 1 108 LEU n 1 109 ALA n 1 110 LYS n 1 111 VAL n 1 112 ALA n 1 113 TYR n 1 114 VAL n 1 115 TYR n 1 116 LYS n 1 117 PRO n 1 118 ASN n 1 119 ASN n 1 120 THR n 1 121 HIS n 1 122 GLU n 1 123 GLN n 1 124 HIS n 1 125 LEU n 1 126 ARG n 1 127 LYS n 1 128 SER n 1 129 GLU n 1 130 ALA n 1 131 GLN n 1 132 ALA n 1 133 LYS n 1 134 LYS n 1 135 GLU n 1 136 LYS n 1 137 LEU n 1 138 ASN n 1 139 ILE n 1 140 TRP n 1 141 SER n 1 142 GLU n 1 143 ASP n 1 144 ASN n 1 145 ALA n 1 146 ASP n 1 147 SER n 1 148 GLY n 1 149 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1280 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain AR120 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PAS1 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NUC_STAAU _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00644 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MLVMTEYLLSAGICMAIVSILLIGMAISNVSKGQYAKRFFFFATSCLVLTLVVVSSLSSSANASQTDNGVNRSGSEDPTV YSATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDK GQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWSEDNADSGQ ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1A3T _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 149 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00644 _struct_ref_seq.db_align_beg 83 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 231 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 149 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1A3T _struct_ref_seq_dif.mon_id EFC _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 23 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P00644 _struct_ref_seq_dif.db_mon_id VAL _struct_ref_seq_dif.pdbx_seq_db_seq_num 105 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 23 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 EFC 'L-peptide linking' n 'S,S-(2-FLUOROETHYL)THIOCYSTEINE' ? 'C5 H10 F N O2 S2' 199.267 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THP 'DNA linking' . "THYMIDINE-3',5'-DIPHOSPHATE" ? 'C10 H16 N2 O11 P2' 402.188 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1A3T _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.41 _exptl_crystal.density_percent_sol 49.0 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.15 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '10 MM POTASSIUM PHOSPHATE, PH 8.15 PROTEIN CONCENTRATION = 2 MGS/ML MPD =21% T=4 DEGREES C, temperature 277K' # _diffrn.id 1 _diffrn.ambient_temp 278.15 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MACSCIENCE _diffrn_detector.pdbx_collection_date 1996-01 _diffrn_detector.details COLLIMATOR # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'NI FILTER' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH2R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1A3T _reflns.observed_criterion_sigma_I 2. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 6.0 _reflns.d_resolution_high 2.10 _reflns.number_obs 6874 _reflns.number_all ? _reflns.percent_possible_obs 83.8 _reflns.pdbx_Rmerge_I_obs 0.0700000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 6.4 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.19 _reflns_shell.percent_possible_all 68.8 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1A3T _refine.ls_number_reflns_obs 6874 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2. _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 6.0 _refine.ls_d_res_high 2.10 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.1620000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1620000 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1SNC' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_overall_phase_error ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1085 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.number_atoms_solvent 38 _refine_hist.number_atoms_total 1149 _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 6.0 # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARAM19X.PRO TOPH19X.PRO 'X-RAY DIFFRACTION' 2 PARAM11.DNA ? 'X-RAY DIFFRACTION' # _struct.entry_id 1A3T _struct.title ;STAPHYLOCOCCAL NUCLEASE, V23C VARIANT, COMPLEX WITH 2-FLUOROETHANE THIOL AND 3',5'-THYMIDINE DIPHOSPHATE ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1A3T _struct_keywords.pdbx_keywords NUCLEASE _struct_keywords.text 'NUCLEASE, UNNATURAL AMINO ACID, HYDROLASE, ENDONUCLEASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 55 ? GLU A 67 ? GLY A 55 GLU A 67 1 ? 13 HELX_P HELX_P2 2 VAL A 99 ? GLN A 106 ? VAL A 99 GLN A 106 1 ? 8 HELX_P HELX_P3 3 GLU A 122 ? LYS A 134 ? GLU A 122 LYS A 134 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A THR 22 C ? ? ? 1_555 A EFC 23 N ? ? A THR 22 A EFC 23 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale2 covale both ? A EFC 23 C ? ? ? 1_555 A LYS 24 N ? ? A EFC 23 A LYS 24 1_555 ? ? ? ? ? ? ? 1.322 ? ? metalc1 metalc ? ? A ASP 21 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 21 A CA 150 1_555 ? ? ? ? ? ? ? 2.532 ? ? metalc2 metalc ? ? A ASP 40 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 40 A CA 150 1_555 ? ? ? ? ? ? ? 2.382 ? ? metalc3 metalc ? ? A THR 41 O ? ? ? 1_555 B CA . CA ? ? A THR 41 A CA 150 1_555 ? ? ? ? ? ? ? 2.845 ? ? metalc4 metalc ? ? B CA . CA ? ? ? 1_555 C THP . O4P ? ? A CA 150 A THP 151 1_555 ? ? ? ? ? ? ? 2.454 ? ? metalc5 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 150 A HOH 205 1_555 ? ? ? ? ? ? ? 1.496 ? ? metalc6 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 150 A HOH 257 1_555 ? ? ? ? ? ? ? 2.569 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 116 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 116 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 117 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 117 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.50 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 10 ? ALA A 12 ? GLU A 10 ALA A 12 A 2 ILE A 72 ? PHE A 76 ? ILE A 72 PHE A 76 A 3 GLY A 88 ? ALA A 94 ? GLY A 88 ALA A 94 A 4 GLN A 30 ? LEU A 36 ? GLN A 30 LEU A 36 A 5 THR A 22 ? TYR A 27 ? THR A 22 TYR A 27 A 6 THR A 13 ? ALA A 17 ? THR A 13 ALA A 17 B 1 VAL A 39 ? THR A 41 ? VAL A 39 THR A 41 B 2 ALA A 109 ? VAL A 111 ? ALA A 109 VAL A 111 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLU A 10 ? O GLU A 10 N VAL A 74 ? N VAL A 74 A 2 3 O GLU A 73 ? O GLU A 73 N TYR A 93 ? N TYR A 93 A 3 4 O GLY A 88 ? O GLY A 88 N ARG A 35 ? N ARG A 35 A 4 5 O GLN A 30 ? O GLN A 30 N TYR A 27 ? N TYR A 27 A 5 6 O LYS A 24 ? O LYS A 24 N LYS A 16 ? N LYS A 16 B 1 2 O ASP A 40 ? O ASP A 40 N LYS A 110 ? N LYS A 110 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 150 ? 6 'BINDING SITE FOR RESIDUE CA A 150' AC2 Software A THP 151 ? 16 'BINDING SITE FOR RESIDUE THP A 151' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 21 ? ASP A 21 . ? 1_555 ? 2 AC1 6 ASP A 40 ? ASP A 40 . ? 1_555 ? 3 AC1 6 THR A 41 ? THR A 41 . ? 1_555 ? 4 AC1 6 THP C . ? THP A 151 . ? 1_555 ? 5 AC1 6 HOH D . ? HOH A 205 . ? 1_555 ? 6 AC1 6 HOH D . ? HOH A 257 . ? 1_555 ? 7 AC2 16 ARG A 35 ? ARG A 35 . ? 1_555 ? 8 AC2 16 LEU A 36 ? LEU A 36 . ? 1_555 ? 9 AC2 16 ASP A 40 ? ASP A 40 . ? 1_555 ? 10 AC2 16 LYS A 71 ? LYS A 71 . ? 3_655 ? 11 AC2 16 ASP A 83 ? ASP A 83 . ? 1_555 ? 12 AC2 16 LYS A 84 ? LYS A 84 . ? 1_555 ? 13 AC2 16 TYR A 85 ? TYR A 85 . ? 1_555 ? 14 AC2 16 ARG A 87 ? ARG A 87 . ? 1_555 ? 15 AC2 16 TYR A 113 ? TYR A 113 . ? 1_555 ? 16 AC2 16 TYR A 115 ? TYR A 115 . ? 1_555 ? 17 AC2 16 CA B . ? CA A 150 . ? 1_555 ? 18 AC2 16 HOH D . ? HOH A 202 . ? 1_555 ? 19 AC2 16 HOH D . ? HOH A 215 . ? 3_555 ? 20 AC2 16 HOH D . ? HOH A 220 . ? 1_555 ? 21 AC2 16 HOH D . ? HOH A 245 . ? 1_555 ? 22 AC2 16 HOH D . ? HOH A 257 . ? 1_555 ? # _database_PDB_matrix.entry_id 1A3T _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1A3T _atom_sites.fract_transf_matrix[1][1] 0.020661 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020661 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015798 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA F H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 LYS 6 6 ? ? ? A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 EFC 23 23 23 EFC EFC A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 MET 65 65 65 MET MET A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 MET 98 98 98 MET MET A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 HIS 121 121 121 HIS HIS A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 HIS 124 124 124 HIS HIS A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 GLN 131 131 131 GLN GLN A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 TRP 140 140 140 TRP TRP A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 GLU 142 142 ? ? ? A . n A 1 143 ASP 143 143 ? ? ? A . n A 1 144 ASN 144 144 ? ? ? A . n A 1 145 ALA 145 145 ? ? ? A . n A 1 146 ASP 146 146 ? ? ? A . n A 1 147 SER 147 147 ? ? ? A . n A 1 148 GLY 148 148 ? ? ? A . n A 1 149 GLN 149 149 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 150 142 CA CA A . C 3 THP 1 151 143 THP THP A . D 4 HOH 1 201 201 HOH HOH A . D 4 HOH 2 202 202 HOH HOH A . D 4 HOH 3 203 203 HOH HOH A . D 4 HOH 4 204 204 HOH HOH A . D 4 HOH 5 205 205 HOH HOH A . D 4 HOH 6 207 207 HOH HOH A . D 4 HOH 7 208 208 HOH HOH A . D 4 HOH 8 209 209 HOH HOH A . D 4 HOH 9 211 211 HOH HOH A . D 4 HOH 10 212 212 HOH HOH A . D 4 HOH 11 213 213 HOH HOH A . D 4 HOH 12 214 214 HOH HOH A . D 4 HOH 13 215 215 HOH HOH A . D 4 HOH 14 216 216 HOH HOH A . D 4 HOH 15 219 219 HOH HOH A . D 4 HOH 16 220 220 HOH HOH A . D 4 HOH 17 221 221 HOH HOH A . D 4 HOH 18 222 222 HOH HOH A . D 4 HOH 19 223 223 HOH HOH A . D 4 HOH 20 224 224 HOH HOH A . D 4 HOH 21 225 225 HOH HOH A . D 4 HOH 22 226 226 HOH HOH A . D 4 HOH 23 227 227 HOH HOH A . D 4 HOH 24 228 228 HOH HOH A . D 4 HOH 25 229 229 HOH HOH A . D 4 HOH 26 230 230 HOH HOH A . D 4 HOH 27 231 231 HOH HOH A . D 4 HOH 28 233 233 HOH HOH A . D 4 HOH 29 234 234 HOH HOH A . D 4 HOH 30 236 236 HOH HOH A . D 4 HOH 31 238 238 HOH HOH A . D 4 HOH 32 240 240 HOH HOH A . D 4 HOH 33 245 245 HOH HOH A . D 4 HOH 34 247 247 HOH HOH A . D 4 HOH 35 249 249 HOH HOH A . D 4 HOH 36 256 256 HOH HOH A . D 4 HOH 37 257 257 HOH HOH A . D 4 HOH 38 258 258 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id EFC _pdbx_struct_mod_residue.label_seq_id 23 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id EFC _pdbx_struct_mod_residue.auth_seq_id 23 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'S,S-(2-FLUOROETHYL)THIOCYSTEINE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 86.3 ? 2 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? A THR 41 ? A THR 41 ? 1_555 91.7 ? 3 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? A THR 41 ? A THR 41 ? 1_555 74.5 ? 4 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O4P ? C THP . ? A THP 151 ? 1_555 98.5 ? 5 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O4P ? C THP . ? A THP 151 ? 1_555 77.6 ? 6 O ? A THR 41 ? A THR 41 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O4P ? C THP . ? A THP 151 ? 1_555 149.6 ? 7 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? D HOH . ? A HOH 205 ? 1_555 89.1 ? 8 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? D HOH . ? A HOH 205 ? 1_555 138.1 ? 9 O ? A THR 41 ? A THR 41 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? D HOH . ? A HOH 205 ? 1_555 64.0 ? 10 O4P ? C THP . ? A THP 151 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? D HOH . ? A HOH 205 ? 1_555 144.1 ? 11 OD2 ? A ASP 21 ? A ASP 21 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? D HOH . ? A HOH 257 ? 1_555 80.5 ? 12 OD1 ? A ASP 40 ? A ASP 40 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? D HOH . ? A HOH 257 ? 1_555 146.7 ? 13 O ? A THR 41 ? A THR 41 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? D HOH . ? A HOH 257 ? 1_555 135.8 ? 14 O4P ? C THP . ? A THP 151 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? D HOH . ? A HOH 257 ? 1_555 74.3 ? 15 O ? D HOH . ? A HOH 205 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O ? D HOH . ? A HOH 257 ? 1_555 72.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-04-29 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-03-14 5 'Structure model' 1 4 2023-08-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' Other 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' struct_ref_seq_dif 3 5 'Structure model' database_2 4 5 'Structure model' pdbx_initial_refinement_model 5 5 'Structure model' pdbx_struct_conn_angle 6 5 'Structure model' struct_conn 7 5 'Structure model' struct_ref_seq_dif 8 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 4 'Structure model' '_struct_ref_seq_dif.details' 3 5 'Structure model' '_database_2.pdbx_DOI' 4 5 'Structure model' '_database_2.pdbx_database_accession' 5 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 5 'Structure model' '_pdbx_struct_conn_angle.value' 18 5 'Structure model' '_struct_conn.pdbx_dist_value' 19 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 20 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 21 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 22 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 23 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 24 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 25 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 26 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 27 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 28 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 29 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 30 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 31 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 32 5 'Structure model' '_struct_ref_seq_dif.details' 33 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 34 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 35 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 X-PLOR phasing . ? 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 HZ3 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LYS _pdbx_validate_close_contact.auth_seq_id_1 53 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 TYR _pdbx_validate_close_contact.auth_seq_id_2 54 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.14 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 45 ? ? -111.11 -80.38 2 1 TYR A 54 ? ? 79.78 -4.35 3 1 ASN A 119 ? ? -142.89 17.31 4 1 ASN A 138 ? ? 35.74 -102.66 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 1 ? A ALA 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A LYS 6 ? A LYS 6 7 1 Y 1 A GLU 142 ? A GLU 142 8 1 Y 1 A ASP 143 ? A ASP 143 9 1 Y 1 A ASN 144 ? A ASN 144 10 1 Y 1 A ALA 145 ? A ALA 145 11 1 Y 1 A ASP 146 ? A ASP 146 12 1 Y 1 A SER 147 ? A SER 147 13 1 Y 1 A GLY 148 ? A GLY 148 14 1 Y 1 A GLN 149 ? A GLN 149 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 "THYMIDINE-3',5'-DIPHOSPHATE" THP 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1SNC _pdbx_initial_refinement_model.details 'PDB ENTRY 1SNC' #