data_1A6I # _entry.id 1A6I # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1A6I pdb_00001a6i 10.2210/pdb1a6i/pdb WWPDB D_1000170453 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1A6I _pdbx_database_status.recvd_initial_deposition_date 1998-02-25 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Orth, P.' 1 'Cordes, F.' 2 'Schnappinger, D.' 3 'Hillen, W.' 4 'Saenger, W.' 5 'Hinrichs, W.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Conformational changes of the Tet repressor induced by tetracycline trapping.' J.Mol.Biol. 279 439 447 1998 JMOBAK UK 0022-2836 0070 ? 9642048 10.1006/jmbi.1998.1775 1 'The Complex Formed between Tet Repressor and Tetracycline-Mg2+ Reveals Mechanism of Antibiotic Resistance' J.Mol.Biol. 247 260 ? 1995 JMOBAK UK 0022-2836 0070 ? ? ? 2 'Structure of the Tet Repressor-Tetracycline Complex and Regulation of Antibiotic Resistance' Science 264 418 ? 1994 SCIEAS US 0036-8075 0038 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Orth, P.' 1 ? primary 'Cordes, F.' 2 ? primary 'Schnappinger, D.' 3 ? primary 'Hillen, W.' 4 ? primary 'Saenger, W.' 5 ? primary 'Hinrichs, W.' 6 ? 1 'Kisker, C.' 7 ? 1 'Hinrichs, W.' 8 ? 1 'Tovar, K.' 9 ? 1 'Hillen, W.' 10 ? 1 'Saenger, W.' 11 ? 2 'Hinrichs, W.' 12 ? 2 'Kisker, C.' 13 ? 2 'Duvel, M.' 14 ? 2 'Muller, A.' 15 ? 2 'Tovar, K.' 16 ? 2 'Hillen, W.' 17 ? 2 'Saenger, W.' 18 ? # _cell.entry_id 1A6I _cell.length_a 69.810 _cell.length_b 69.810 _cell.length_c 184.950 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1A6I _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'TETRACYCLINE REPRESSOR PROTEIN CLASS D' 24319.691 1 ? 'A2S, N5D, R6K, E7S, S8K, D11N, A12S, T20V, D23E, I36V' ? ? 2 water nat water 18.015 28 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TET REPRESSOR, CLASS D' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLRN NAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGFSLRDGLYAISAVSHFTLGAVLEQQEHTAALTDRPAA PDENLPPLLREALQIMDSDDGEQAFLHGLESLIRGFEVQLTALLQIVGGDKLIIPFC ; _entity_poly.pdbx_seq_one_letter_code_can ;SRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLRN NAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGFSLRDGLYAISAVSHFTLGAVLEQQEHTAALTDRPAA PDENLPPLLREALQIMDSDDGEQAFLHGLESLIRGFEVQLTALLQIVGGDKLIIPFC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ARG n 1 3 LEU n 1 4 ASP n 1 5 LYS n 1 6 SER n 1 7 LYS n 1 8 VAL n 1 9 ILE n 1 10 ASN n 1 11 SER n 1 12 ALA n 1 13 LEU n 1 14 GLU n 1 15 LEU n 1 16 LEU n 1 17 ASN n 1 18 GLU n 1 19 VAL n 1 20 GLY n 1 21 ILE n 1 22 GLU n 1 23 GLY n 1 24 LEU n 1 25 THR n 1 26 THR n 1 27 ARG n 1 28 LYS n 1 29 LEU n 1 30 ALA n 1 31 GLN n 1 32 LYS n 1 33 LEU n 1 34 GLY n 1 35 VAL n 1 36 GLU n 1 37 GLN n 1 38 PRO n 1 39 THR n 1 40 LEU n 1 41 TYR n 1 42 TRP n 1 43 HIS n 1 44 VAL n 1 45 LYS n 1 46 ASN n 1 47 LYS n 1 48 ARG n 1 49 ALA n 1 50 LEU n 1 51 LEU n 1 52 ASP n 1 53 ALA n 1 54 LEU n 1 55 ALA n 1 56 VAL n 1 57 GLU n 1 58 ILE n 1 59 LEU n 1 60 ALA n 1 61 ARG n 1 62 HIS n 1 63 HIS n 1 64 ASP n 1 65 TYR n 1 66 SER n 1 67 LEU n 1 68 PRO n 1 69 ALA n 1 70 ALA n 1 71 GLY n 1 72 GLU n 1 73 SER n 1 74 TRP n 1 75 GLN n 1 76 SER n 1 77 PHE n 1 78 LEU n 1 79 ARG n 1 80 ASN n 1 81 ASN n 1 82 ALA n 1 83 MET n 1 84 SER n 1 85 PHE n 1 86 ARG n 1 87 ARG n 1 88 ALA n 1 89 LEU n 1 90 LEU n 1 91 ARG n 1 92 TYR n 1 93 ARG n 1 94 ASP n 1 95 GLY n 1 96 ALA n 1 97 LYS n 1 98 VAL n 1 99 HIS n 1 100 LEU n 1 101 GLY n 1 102 THR n 1 103 ARG n 1 104 PRO n 1 105 ASP n 1 106 GLU n 1 107 LYS n 1 108 GLN n 1 109 TYR n 1 110 ASP n 1 111 THR n 1 112 VAL n 1 113 GLU n 1 114 THR n 1 115 GLN n 1 116 LEU n 1 117 ARG n 1 118 PHE n 1 119 MET n 1 120 THR n 1 121 GLU n 1 122 ASN n 1 123 GLY n 1 124 PHE n 1 125 SER n 1 126 LEU n 1 127 ARG n 1 128 ASP n 1 129 GLY n 1 130 LEU n 1 131 TYR n 1 132 ALA n 1 133 ILE n 1 134 SER n 1 135 ALA n 1 136 VAL n 1 137 SER n 1 138 HIS n 1 139 PHE n 1 140 THR n 1 141 LEU n 1 142 GLY n 1 143 ALA n 1 144 VAL n 1 145 LEU n 1 146 GLU n 1 147 GLN n 1 148 GLN n 1 149 GLU n 1 150 HIS n 1 151 THR n 1 152 ALA n 1 153 ALA n 1 154 LEU n 1 155 THR n 1 156 ASP n 1 157 ARG n 1 158 PRO n 1 159 ALA n 1 160 ALA n 1 161 PRO n 1 162 ASP n 1 163 GLU n 1 164 ASN n 1 165 LEU n 1 166 PRO n 1 167 PRO n 1 168 LEU n 1 169 LEU n 1 170 ARG n 1 171 GLU n 1 172 ALA n 1 173 LEU n 1 174 GLN n 1 175 ILE n 1 176 MET n 1 177 ASP n 1 178 SER n 1 179 ASP n 1 180 ASP n 1 181 GLY n 1 182 GLU n 1 183 GLN n 1 184 ALA n 1 185 PHE n 1 186 LEU n 1 187 HIS n 1 188 GLY n 1 189 LEU n 1 190 GLU n 1 191 SER n 1 192 LEU n 1 193 ILE n 1 194 ARG n 1 195 GLY n 1 196 PHE n 1 197 GLU n 1 198 VAL n 1 199 GLN n 1 200 LEU n 1 201 THR n 1 202 ALA n 1 203 LEU n 1 204 LEU n 1 205 GLN n 1 206 ILE n 1 207 VAL n 1 208 GLY n 1 209 GLY n 1 210 ASP n 1 211 LYS n 1 212 LEU n 1 213 ILE n 1 214 ILE n 1 215 PRO n 1 216 PHE n 1 217 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'K12 DELTA H1 DELTA TRP' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location CYTOPLASM _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PWH610 (B/D)51-208' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TETR4_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P0ACT4 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;ARLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLRN NAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGFSLRDGLYAISAVSHFTLGAVLEQQEHTAALTDRPAA PDENLPPLLREALQIMDSDDGEQAFLHGLESLIRGFEVQLTALLQIVGGDKLIIPFC ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1A6I _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 217 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0ACT4 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 217 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 218 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1A6I ASP A 4 ? UNP P0ACT4 ASN 4 'engineered mutation' 5 1 1 1A6I LYS A 5 ? UNP P0ACT4 ARG 5 'engineered mutation' 6 2 1 1A6I SER A 6 ? UNP P0ACT4 GLU 6 'engineered mutation' 7 3 1 1A6I LYS A 7 ? UNP P0ACT4 SER 7 'engineered mutation' 8 4 1 1A6I ASN A 10 ? UNP P0ACT4 ASP 10 'engineered mutation' 11 5 1 1A6I SER A 11 ? UNP P0ACT4 ALA 11 'engineered mutation' 12 6 1 1A6I VAL A 19 ? UNP P0ACT4 THR 19 'engineered mutation' 20 7 1 1A6I GLU A 22 ? UNP P0ACT4 ASP 22 'engineered mutation' 23 8 1 1A6I VAL A 35 ? UNP P0ACT4 ILE 35 'engineered mutation' 36 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1A6I _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.4 _exptl_crystal.density_percent_sol 49 _exptl_crystal.description 'DATA WERE COLLECTED USING THE OSCILLATION METHOD' # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 8.0' # _diffrn.id 1 _diffrn.ambient_temp 277 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 1995-12 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.92 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'LURE BEAMLINE DW32' _diffrn_source.pdbx_synchrotron_site LURE _diffrn_source.pdbx_synchrotron_beamline DW32 _diffrn_source.pdbx_wavelength 0.92 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1A6I _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 18.5 _reflns.d_resolution_high 2.4 _reflns.number_obs 9076 _reflns.number_all ? _reflns.percent_possible_obs 97.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.0730000 _reflns.pdbx_netI_over_sigmaI 6.13 _reflns.B_iso_Wilson_estimate 42.4 _reflns.pdbx_redundancy 4.8 _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.40 _reflns_shell.d_res_low 2.47 _reflns_shell.percent_possible_all 98.6 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.2480000 _reflns_shell.meanI_over_sigI_obs 2.9 _reflns_shell.pdbx_redundancy 4.9 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1A6I _refine.ls_number_reflns_obs 9076 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 100000.00 _refine.pdbx_data_cutoff_low_absF 0.1 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 18.5 _refine.ls_d_res_high 2.4 _refine.ls_percent_reflns_obs 97.8 _refine.ls_R_factor_obs 0.2140000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2140000 _refine.ls_R_factor_R_free 0.2750000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10. _refine.ls_number_reflns_R_free 909 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 47.6 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 2TCT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1A6I _refine_analyze.Luzzati_coordinate_error_obs 0.35 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs 10.0 _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1539 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 28 _refine_hist.number_atoms_total 1567 _refine_hist.d_res_high 2.4 _refine_hist.d_res_low 18.5 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.20 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 19.9 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.18 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it 1.90 2.50 ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it 2.29 3.00 ? ? 'X-RAY DIFFRACTION' ? x_scbond_it 2.49 3.00 ? ? 'X-RAY DIFFRACTION' ? x_scangle_it 2.90 3.50 ? ? 'X-RAY DIFFRACTION' ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 2 PARAM19.SOL TOPH19.PEP 'X-RAY DIFFRACTION' 3 ? TOPH19.SOL 'X-RAY DIFFRACTION' 4 ? TOPH19.HIS 'X-RAY DIFFRACTION' # _struct.entry_id 1A6I _struct.title 'TET REPRESSOR, CLASS D VARIANT' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1A6I _struct_keywords.pdbx_keywords 'TRANSCRIPTION REGULATION' _struct_keywords.text 'TRANSCRIPTION REGULATION, REPRESSOR, DNA-BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 5 ? VAL A 19 ? LYS A 6 VAL A 20 1 ? 15 HELX_P HELX_P2 2 THR A 26 ? LEU A 33 ? THR A 27 LEU A 34 1 ? 8 HELX_P HELX_P3 3 GLN A 37 ? HIS A 43 ? GLN A 38 HIS A 44 1 ? 7 HELX_P HELX_P4 4 LYS A 47 ? HIS A 62 ? LYS A 48 HIS A 63 1 ? 16 HELX_P HELX_P5 5 TRP A 74 ? LEU A 90 ? TRP A 75 LEU A 91 1 ? 17 HELX_P HELX_P6 6 GLY A 95 ? GLY A 101 ? GLY A 96 GLY A 102 1 ? 7 HELX_P HELX_P7 7 GLU A 106 ? ASN A 122 ? GLU A 107 ASN A 123 1 ? 17 HELX_P HELX_P8 8 LEU A 126 ? GLU A 149 ? LEU A 127 GLU A 150 1 ? 24 HELX_P HELX_P9 9 PRO A 167 ? ASP A 177 ? PRO A 168 ASP A 178 1 ? 11 HELX_P HELX_P10 10 GLU A 182 ? ALA A 202 ? GLU A 183 ALA A 203 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_site.id TNE _struct_site.pdbx_evidence_code Unknown _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 7 _struct_site.details 'EMPTY TETRACYCLINE BINDING TUNNEL.' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 TNE 7 HIS A 63 ? HIS A 64 . ? 1_555 ? 2 TNE 7 ASN A 81 ? ASN A 82 . ? 1_555 ? 3 TNE 7 PHE A 85 ? PHE A 86 . ? 1_555 ? 4 TNE 7 HIS A 99 ? HIS A 100 . ? 1_555 ? 5 TNE 7 THR A 102 ? THR A 103 . ? 1_555 ? 6 TNE 7 GLN A 115 ? GLN A 116 . ? 1_555 ? 7 TNE 7 MET A 176 ? MET A 177 . ? 1_555 ? # _database_PDB_matrix.entry_id 1A6I _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1A6I _atom_sites.fract_transf_matrix[1][1] 0.014325 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014325 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005407 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 2 2 SER SER A . n A 1 2 ARG 2 3 3 ARG ARG A . n A 1 3 LEU 3 4 4 LEU LEU A . n A 1 4 ASP 4 5 5 ASP ASP A . n A 1 5 LYS 5 6 6 LYS LYS A . n A 1 6 SER 6 7 7 SER SER A . n A 1 7 LYS 7 8 8 LYS LYS A . n A 1 8 VAL 8 9 9 VAL VAL A . n A 1 9 ILE 9 10 10 ILE ILE A . n A 1 10 ASN 10 11 11 ASN ASN A . n A 1 11 SER 11 12 12 SER SER A . n A 1 12 ALA 12 13 13 ALA ALA A . n A 1 13 LEU 13 14 14 LEU LEU A . n A 1 14 GLU 14 15 15 GLU GLU A . n A 1 15 LEU 15 16 16 LEU LEU A . n A 1 16 LEU 16 17 17 LEU LEU A . n A 1 17 ASN 17 18 18 ASN ASN A . n A 1 18 GLU 18 19 19 GLU GLU A . n A 1 19 VAL 19 20 20 VAL VAL A . n A 1 20 GLY 20 21 21 GLY GLY A . n A 1 21 ILE 21 22 22 ILE ILE A . n A 1 22 GLU 22 23 23 GLU GLU A . n A 1 23 GLY 23 24 24 GLY GLY A . n A 1 24 LEU 24 25 25 LEU LEU A . n A 1 25 THR 25 26 26 THR THR A . n A 1 26 THR 26 27 27 THR THR A . n A 1 27 ARG 27 28 28 ARG ARG A . n A 1 28 LYS 28 29 29 LYS LYS A . n A 1 29 LEU 29 30 30 LEU LEU A . n A 1 30 ALA 30 31 31 ALA ALA A . n A 1 31 GLN 31 32 32 GLN GLN A . n A 1 32 LYS 32 33 33 LYS LYS A . n A 1 33 LEU 33 34 34 LEU LEU A . n A 1 34 GLY 34 35 35 GLY GLY A . n A 1 35 VAL 35 36 36 VAL VAL A . n A 1 36 GLU 36 37 37 GLU GLU A . n A 1 37 GLN 37 38 38 GLN GLN A . n A 1 38 PRO 38 39 39 PRO PRO A . n A 1 39 THR 39 40 40 THR THR A . n A 1 40 LEU 40 41 41 LEU LEU A . n A 1 41 TYR 41 42 42 TYR TYR A . n A 1 42 TRP 42 43 43 TRP TRP A . n A 1 43 HIS 43 44 44 HIS HIS A . n A 1 44 VAL 44 45 45 VAL VAL A . n A 1 45 LYS 45 46 46 LYS LYS A . n A 1 46 ASN 46 47 47 ASN ASN A . n A 1 47 LYS 47 48 48 LYS LYS A . n A 1 48 ARG 48 49 49 ARG ARG A . n A 1 49 ALA 49 50 50 ALA ALA A . n A 1 50 LEU 50 51 51 LEU LEU A . n A 1 51 LEU 51 52 52 LEU LEU A . n A 1 52 ASP 52 53 53 ASP ASP A . n A 1 53 ALA 53 54 54 ALA ALA A . n A 1 54 LEU 54 55 55 LEU LEU A . n A 1 55 ALA 55 56 56 ALA ALA A . n A 1 56 VAL 56 57 57 VAL VAL A . n A 1 57 GLU 57 58 58 GLU GLU A . n A 1 58 ILE 58 59 59 ILE ILE A . n A 1 59 LEU 59 60 60 LEU LEU A . n A 1 60 ALA 60 61 61 ALA ALA A . n A 1 61 ARG 61 62 62 ARG ARG A . n A 1 62 HIS 62 63 63 HIS HIS A . n A 1 63 HIS 63 64 64 HIS HIS A . n A 1 64 ASP 64 65 65 ASP ASP A . n A 1 65 TYR 65 66 66 TYR TYR A . n A 1 66 SER 66 67 67 SER SER A . n A 1 67 LEU 67 68 68 LEU LEU A . n A 1 68 PRO 68 69 69 PRO PRO A . n A 1 69 ALA 69 70 70 ALA ALA A . n A 1 70 ALA 70 71 71 ALA ALA A . n A 1 71 GLY 71 72 72 GLY GLY A . n A 1 72 GLU 72 73 73 GLU GLU A . n A 1 73 SER 73 74 74 SER SER A . n A 1 74 TRP 74 75 75 TRP TRP A . n A 1 75 GLN 75 76 76 GLN GLN A . n A 1 76 SER 76 77 77 SER SER A . n A 1 77 PHE 77 78 78 PHE PHE A . n A 1 78 LEU 78 79 79 LEU LEU A . n A 1 79 ARG 79 80 80 ARG ARG A . n A 1 80 ASN 80 81 81 ASN ASN A . n A 1 81 ASN 81 82 82 ASN ASN A . n A 1 82 ALA 82 83 83 ALA ALA A . n A 1 83 MET 83 84 84 MET MET A . n A 1 84 SER 84 85 85 SER SER A . n A 1 85 PHE 85 86 86 PHE PHE A . n A 1 86 ARG 86 87 87 ARG ARG A . n A 1 87 ARG 87 88 88 ARG ARG A . n A 1 88 ALA 88 89 89 ALA ALA A . n A 1 89 LEU 89 90 90 LEU LEU A . n A 1 90 LEU 90 91 91 LEU LEU A . n A 1 91 ARG 91 92 92 ARG ARG A . n A 1 92 TYR 92 93 93 TYR TYR A . n A 1 93 ARG 93 94 94 ARG ARG A . n A 1 94 ASP 94 95 95 ASP ASP A . n A 1 95 GLY 95 96 96 GLY GLY A . n A 1 96 ALA 96 97 97 ALA ALA A . n A 1 97 LYS 97 98 98 LYS LYS A . n A 1 98 VAL 98 99 99 VAL VAL A . n A 1 99 HIS 99 100 100 HIS HIS A . n A 1 100 LEU 100 101 101 LEU LEU A . n A 1 101 GLY 101 102 102 GLY GLY A . n A 1 102 THR 102 103 103 THR THR A . n A 1 103 ARG 103 104 104 ARG ARG A . n A 1 104 PRO 104 105 105 PRO PRO A . n A 1 105 ASP 105 106 106 ASP ASP A . n A 1 106 GLU 106 107 107 GLU GLU A . n A 1 107 LYS 107 108 108 LYS LYS A . n A 1 108 GLN 108 109 109 GLN GLN A . n A 1 109 TYR 109 110 110 TYR TYR A . n A 1 110 ASP 110 111 111 ASP ASP A . n A 1 111 THR 111 112 112 THR THR A . n A 1 112 VAL 112 113 113 VAL VAL A . n A 1 113 GLU 113 114 114 GLU GLU A . n A 1 114 THR 114 115 115 THR THR A . n A 1 115 GLN 115 116 116 GLN GLN A . n A 1 116 LEU 116 117 117 LEU LEU A . n A 1 117 ARG 117 118 118 ARG ARG A . n A 1 118 PHE 118 119 119 PHE PHE A . n A 1 119 MET 119 120 120 MET MET A . n A 1 120 THR 120 121 121 THR THR A . n A 1 121 GLU 121 122 122 GLU GLU A . n A 1 122 ASN 122 123 123 ASN ASN A . n A 1 123 GLY 123 124 124 GLY GLY A . n A 1 124 PHE 124 125 125 PHE PHE A . n A 1 125 SER 125 126 126 SER SER A . n A 1 126 LEU 126 127 127 LEU LEU A . n A 1 127 ARG 127 128 128 ARG ARG A . n A 1 128 ASP 128 129 129 ASP ASP A . n A 1 129 GLY 129 130 130 GLY GLY A . n A 1 130 LEU 130 131 131 LEU LEU A . n A 1 131 TYR 131 132 132 TYR TYR A . n A 1 132 ALA 132 133 133 ALA ALA A . n A 1 133 ILE 133 134 134 ILE ILE A . n A 1 134 SER 134 135 135 SER SER A . n A 1 135 ALA 135 136 136 ALA ALA A . n A 1 136 VAL 136 137 137 VAL VAL A . n A 1 137 SER 137 138 138 SER SER A . n A 1 138 HIS 138 139 139 HIS HIS A . n A 1 139 PHE 139 140 140 PHE PHE A . n A 1 140 THR 140 141 141 THR THR A . n A 1 141 LEU 141 142 142 LEU LEU A . n A 1 142 GLY 142 143 143 GLY GLY A . n A 1 143 ALA 143 144 144 ALA ALA A . n A 1 144 VAL 144 145 145 VAL VAL A . n A 1 145 LEU 145 146 146 LEU LEU A . n A 1 146 GLU 146 147 147 GLU GLU A . n A 1 147 GLN 147 148 148 GLN GLN A . n A 1 148 GLN 148 149 149 GLN GLN A . n A 1 149 GLU 149 150 150 GLU GLU A . n A 1 150 HIS 150 151 151 HIS HIS A . n A 1 151 THR 151 152 ? ? ? A . n A 1 152 ALA 152 153 ? ? ? A . n A 1 153 ALA 153 154 ? ? ? A . n A 1 154 LEU 154 155 ? ? ? A . n A 1 155 THR 155 156 ? ? ? A . n A 1 156 ASP 156 157 ? ? ? A . n A 1 157 ARG 157 158 ? ? ? A . n A 1 158 PRO 158 159 ? ? ? A . n A 1 159 ALA 159 160 ? ? ? A . n A 1 160 ALA 160 161 ? ? ? A . n A 1 161 PRO 161 162 ? ? ? A . n A 1 162 ASP 162 163 ? ? ? A . n A 1 163 GLU 163 164 ? ? ? A . n A 1 164 ASN 164 165 ? ? ? A . n A 1 165 LEU 165 166 166 LEU LEU A . n A 1 166 PRO 166 167 167 PRO PRO A . n A 1 167 PRO 167 168 168 PRO PRO A . n A 1 168 LEU 168 169 169 LEU LEU A . n A 1 169 LEU 169 170 170 LEU LEU A . n A 1 170 ARG 170 171 171 ARG ARG A . n A 1 171 GLU 171 172 172 GLU GLU A . n A 1 172 ALA 172 173 173 ALA ALA A . n A 1 173 LEU 173 174 174 LEU LEU A . n A 1 174 GLN 174 175 175 GLN GLN A . n A 1 175 ILE 175 176 176 ILE ILE A . n A 1 176 MET 176 177 177 MET MET A . n A 1 177 ASP 177 178 178 ASP ASP A . n A 1 178 SER 178 179 179 SER SER A . n A 1 179 ASP 179 180 180 ASP ASP A . n A 1 180 ASP 180 181 181 ASP ASP A . n A 1 181 GLY 181 182 182 GLY GLY A . n A 1 182 GLU 182 183 183 GLU GLU A . n A 1 183 GLN 183 184 184 GLN GLN A . n A 1 184 ALA 184 185 185 ALA ALA A . n A 1 185 PHE 185 186 186 PHE PHE A . n A 1 186 LEU 186 187 187 LEU LEU A . n A 1 187 HIS 187 188 188 HIS HIS A . n A 1 188 GLY 188 189 189 GLY GLY A . n A 1 189 LEU 189 190 190 LEU LEU A . n A 1 190 GLU 190 191 191 GLU GLU A . n A 1 191 SER 191 192 192 SER SER A . n A 1 192 LEU 192 193 193 LEU LEU A . n A 1 193 ILE 193 194 194 ILE ILE A . n A 1 194 ARG 194 195 195 ARG ARG A . n A 1 195 GLY 195 196 196 GLY GLY A . n A 1 196 PHE 196 197 197 PHE PHE A . n A 1 197 GLU 197 198 198 GLU GLU A . n A 1 198 VAL 198 199 199 VAL VAL A . n A 1 199 GLN 199 200 200 GLN GLN A . n A 1 200 LEU 200 201 201 LEU LEU A . n A 1 201 THR 201 202 202 THR THR A . n A 1 202 ALA 202 203 203 ALA ALA A . n A 1 203 LEU 203 204 204 LEU LEU A . n A 1 204 LEU 204 205 205 LEU LEU A . n A 1 205 GLN 205 206 206 GLN GLN A . n A 1 206 ILE 206 207 207 ILE ILE A . n A 1 207 VAL 207 208 208 VAL VAL A . n A 1 208 GLY 208 209 ? ? ? A . n A 1 209 GLY 209 210 ? ? ? A . n A 1 210 ASP 210 211 ? ? ? A . n A 1 211 LYS 211 212 ? ? ? A . n A 1 212 LEU 212 213 ? ? ? A . n A 1 213 ILE 213 214 ? ? ? A . n A 1 214 ILE 214 215 ? ? ? A . n A 1 215 PRO 215 216 ? ? ? A . n A 1 216 PHE 216 217 ? ? ? A . n A 1 217 CYS 217 218 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 301 HOH HOH A . B 2 HOH 2 302 302 HOH HOH A . B 2 HOH 3 303 303 HOH HOH A . B 2 HOH 4 304 304 HOH HOH A . B 2 HOH 5 305 305 HOH HOH A . B 2 HOH 6 306 306 HOH HOH A . B 2 HOH 7 307 307 HOH HOH A . B 2 HOH 8 308 308 HOH HOH A . B 2 HOH 9 309 309 HOH HOH A . B 2 HOH 10 310 310 HOH HOH A . B 2 HOH 11 311 311 HOH HOH A . B 2 HOH 12 312 312 HOH HOH A . B 2 HOH 13 313 313 HOH HOH A . B 2 HOH 14 314 314 HOH HOH A . B 2 HOH 15 315 315 HOH HOH A . B 2 HOH 16 316 316 HOH HOH A . B 2 HOH 17 317 317 HOH HOH A . B 2 HOH 18 318 318 HOH HOH A . B 2 HOH 19 319 319 HOH HOH A . B 2 HOH 20 320 320 HOH HOH A . B 2 HOH 21 321 321 HOH HOH A . B 2 HOH 22 322 322 HOH HOH A . B 2 HOH 23 323 323 HOH HOH A . B 2 HOH 24 324 324 HOH HOH A . B 2 HOH 25 325 325 HOH HOH A . B 2 HOH 26 326 326 HOH HOH A . B 2 HOH 27 327 327 HOH HOH A . B 2 HOH 28 328 328 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4440 ? 1 MORE -44 ? 1 'SSA (A^2)' 19490 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 10_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 69.8100000000 0.0000000000 -1.0000000000 0.0000000000 69.8100000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-03-02 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 5 'Structure model' 1 4 2023-08-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other 6 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' struct_ref_seq_dif 4 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 MOSFLM 'data reduction' . ? 3 CCP4 'data scaling' . ? 4 X-PLOR phasing 3.1 ? 5 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 PRO _pdbx_validate_rmsd_angle.auth_seq_id_1 167 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 168 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CA _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 168 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 129.22 _pdbx_validate_rmsd_angle.angle_target_value 119.30 _pdbx_validate_rmsd_angle.angle_deviation 9.92 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.50 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 4 ? ? -108.30 55.67 2 1 HIS A 63 ? ? -140.77 -24.59 3 1 TYR A 66 ? ? -97.37 57.19 4 1 PRO A 168 ? ? -44.10 -77.56 5 1 SER A 179 ? ? -73.17 28.72 6 1 LEU A 204 ? ? 55.80 -127.82 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 152 ? A THR 151 2 1 Y 1 A ALA 153 ? A ALA 152 3 1 Y 1 A ALA 154 ? A ALA 153 4 1 Y 1 A LEU 155 ? A LEU 154 5 1 Y 1 A THR 156 ? A THR 155 6 1 Y 1 A ASP 157 ? A ASP 156 7 1 Y 1 A ARG 158 ? A ARG 157 8 1 Y 1 A PRO 159 ? A PRO 158 9 1 Y 1 A ALA 160 ? A ALA 159 10 1 Y 1 A ALA 161 ? A ALA 160 11 1 Y 1 A PRO 162 ? A PRO 161 12 1 Y 1 A ASP 163 ? A ASP 162 13 1 Y 1 A GLU 164 ? A GLU 163 14 1 Y 1 A ASN 165 ? A ASN 164 15 1 Y 1 A GLY 209 ? A GLY 208 16 1 Y 1 A GLY 210 ? A GLY 209 17 1 Y 1 A ASP 211 ? A ASP 210 18 1 Y 1 A LYS 212 ? A LYS 211 19 1 Y 1 A LEU 213 ? A LEU 212 20 1 Y 1 A ILE 214 ? A ILE 213 21 1 Y 1 A ILE 215 ? A ILE 214 22 1 Y 1 A PRO 216 ? A PRO 215 23 1 Y 1 A PHE 217 ? A PHE 216 24 1 Y 1 A CYS 218 ? A CYS 217 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2TCT _pdbx_initial_refinement_model.details ? #