data_1AEU # _entry.id 1AEU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1AEU pdb_00001aeu 10.2210/pdb1aeu/pdb WWPDB D_1000170729 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1AEU _pdbx_database_status.recvd_initial_deposition_date 1997-02-25 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Musah, R.A.' 1 'Jensen, G.M.' 2 'Fitzgerald, M.M.' 3 'Mcree, D.E.' 4 'Goodin, D.B.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'A ligand-gated, hinged loop rearrangement opens a channel to a buried artificial protein cavity.' Nat.Struct.Biol. 3 626 631 1996 NSBIEW US 1072-8368 2024 ? 8673607 10.1038/nsb0796-626 1 'Small Molecule Binding to an Artificially Created Cavity at the Active Site of Cytochrome C Peroxidase' Biochemistry 33 3807 ? 1994 BICHAW US 0006-2960 0033 ? ? ? 2 ;The Asp-His-Fe Triad of Cytochrome C Peroxidase Controls the Reduction Potential, Electronic Structure, and Coupling of the Tryptophan Free Radical to the Heme ; Biochemistry 32 3313 ? 1993 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fitzgerald, M.M.' 1 ? primary 'Musah, R.A.' 2 ? primary 'McRee, D.E.' 3 ? primary 'Goodin, D.B.' 4 ? 1 'Fitzgerald, M.M.' 5 ? 1 'Churchill, M.J.' 6 ? 1 'Mcree, D.E.' 7 ? 1 'Goodin, D.B.' 8 ? 2 'Goodin, D.B.' 9 ? 2 'Mcree, D.E.' 10 ? # _cell.entry_id 1AEU _cell.length_a 105.200 _cell.length_b 74.300 _cell.length_c 45.400 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1AEU _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CYTOCHROME C PEROXIDASE' 33459.242 1 1.11.1.5 W191G ? 'CRYSTAL FORM MKT' 2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? 3 non-polymer syn 2-METHYLIMIDAZOLE 82.104 1 ? ? ? ? 4 water nat water 18.015 49 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name CCP/W191G # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKTLVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHISGTWDKHDNTGGSYGGTYRFKKEFNDP SNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLPDADKDAGYVRTFFQR LNMNDREVVALMGAHALGKTHLKNSGYEGPGGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGYMMLPTDYSLIQ DPKYLSIVKEYANDQDKFFKDFSKAFEKLLEDGITFPKDAPSPFIFKTLEEQGL ; _entity_poly.pdbx_seq_one_letter_code_can ;MKTLVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHISGTWDKHDNTGGSYGGTYRFKKEFNDP SNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLPDADKDAGYVRTFFQR LNMNDREVVALMGAHALGKTHLKNSGYEGPGGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGYMMLPTDYSLIQ DPKYLSIVKEYANDQDKFFKDFSKAFEKLLEDGITFPKDAPSPFIFKTLEEQGL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 THR n 1 4 LEU n 1 5 VAL n 1 6 HIS n 1 7 VAL n 1 8 ALA n 1 9 SER n 1 10 VAL n 1 11 GLU n 1 12 LYS n 1 13 GLY n 1 14 ARG n 1 15 SER n 1 16 TYR n 1 17 GLU n 1 18 ASP n 1 19 PHE n 1 20 GLN n 1 21 LYS n 1 22 VAL n 1 23 TYR n 1 24 ASN n 1 25 ALA n 1 26 ILE n 1 27 ALA n 1 28 LEU n 1 29 LYS n 1 30 LEU n 1 31 ARG n 1 32 GLU n 1 33 ASP n 1 34 ASP n 1 35 GLU n 1 36 TYR n 1 37 ASP n 1 38 ASN n 1 39 TYR n 1 40 ILE n 1 41 GLY n 1 42 TYR n 1 43 GLY n 1 44 PRO n 1 45 VAL n 1 46 LEU n 1 47 VAL n 1 48 ARG n 1 49 LEU n 1 50 ALA n 1 51 TRP n 1 52 HIS n 1 53 ILE n 1 54 SER n 1 55 GLY n 1 56 THR n 1 57 TRP n 1 58 ASP n 1 59 LYS n 1 60 HIS n 1 61 ASP n 1 62 ASN n 1 63 THR n 1 64 GLY n 1 65 GLY n 1 66 SER n 1 67 TYR n 1 68 GLY n 1 69 GLY n 1 70 THR n 1 71 TYR n 1 72 ARG n 1 73 PHE n 1 74 LYS n 1 75 LYS n 1 76 GLU n 1 77 PHE n 1 78 ASN n 1 79 ASP n 1 80 PRO n 1 81 SER n 1 82 ASN n 1 83 ALA n 1 84 GLY n 1 85 LEU n 1 86 GLN n 1 87 ASN n 1 88 GLY n 1 89 PHE n 1 90 LYS n 1 91 PHE n 1 92 LEU n 1 93 GLU n 1 94 PRO n 1 95 ILE n 1 96 HIS n 1 97 LYS n 1 98 GLU n 1 99 PHE n 1 100 PRO n 1 101 TRP n 1 102 ILE n 1 103 SER n 1 104 SER n 1 105 GLY n 1 106 ASP n 1 107 LEU n 1 108 PHE n 1 109 SER n 1 110 LEU n 1 111 GLY n 1 112 GLY n 1 113 VAL n 1 114 THR n 1 115 ALA n 1 116 VAL n 1 117 GLN n 1 118 GLU n 1 119 MET n 1 120 GLN n 1 121 GLY n 1 122 PRO n 1 123 LYS n 1 124 ILE n 1 125 PRO n 1 126 TRP n 1 127 ARG n 1 128 CYS n 1 129 GLY n 1 130 ARG n 1 131 VAL n 1 132 ASP n 1 133 THR n 1 134 PRO n 1 135 GLU n 1 136 ASP n 1 137 THR n 1 138 THR n 1 139 PRO n 1 140 ASP n 1 141 ASN n 1 142 GLY n 1 143 ARG n 1 144 LEU n 1 145 PRO n 1 146 ASP n 1 147 ALA n 1 148 ASP n 1 149 LYS n 1 150 ASP n 1 151 ALA n 1 152 GLY n 1 153 TYR n 1 154 VAL n 1 155 ARG n 1 156 THR n 1 157 PHE n 1 158 PHE n 1 159 GLN n 1 160 ARG n 1 161 LEU n 1 162 ASN n 1 163 MET n 1 164 ASN n 1 165 ASP n 1 166 ARG n 1 167 GLU n 1 168 VAL n 1 169 VAL n 1 170 ALA n 1 171 LEU n 1 172 MET n 1 173 GLY n 1 174 ALA n 1 175 HIS n 1 176 ALA n 1 177 LEU n 1 178 GLY n 1 179 LYS n 1 180 THR n 1 181 HIS n 1 182 LEU n 1 183 LYS n 1 184 ASN n 1 185 SER n 1 186 GLY n 1 187 TYR n 1 188 GLU n 1 189 GLY n 1 190 PRO n 1 191 GLY n 1 192 GLY n 1 193 ALA n 1 194 ALA n 1 195 ASN n 1 196 ASN n 1 197 VAL n 1 198 PHE n 1 199 THR n 1 200 ASN n 1 201 GLU n 1 202 PHE n 1 203 TYR n 1 204 LEU n 1 205 ASN n 1 206 LEU n 1 207 LEU n 1 208 ASN n 1 209 GLU n 1 210 ASP n 1 211 TRP n 1 212 LYS n 1 213 LEU n 1 214 GLU n 1 215 LYS n 1 216 ASN n 1 217 ASP n 1 218 ALA n 1 219 ASN n 1 220 ASN n 1 221 GLU n 1 222 GLN n 1 223 TRP n 1 224 ASP n 1 225 SER n 1 226 LYS n 1 227 SER n 1 228 GLY n 1 229 TYR n 1 230 MET n 1 231 MET n 1 232 LEU n 1 233 PRO n 1 234 THR n 1 235 ASP n 1 236 TYR n 1 237 SER n 1 238 LEU n 1 239 ILE n 1 240 GLN n 1 241 ASP n 1 242 PRO n 1 243 LYS n 1 244 TYR n 1 245 LEU n 1 246 SER n 1 247 ILE n 1 248 VAL n 1 249 LYS n 1 250 GLU n 1 251 TYR n 1 252 ALA n 1 253 ASN n 1 254 ASP n 1 255 GLN n 1 256 ASP n 1 257 LYS n 1 258 PHE n 1 259 PHE n 1 260 LYS n 1 261 ASP n 1 262 PHE n 1 263 SER n 1 264 LYS n 1 265 ALA n 1 266 PHE n 1 267 GLU n 1 268 LYS n 1 269 LEU n 1 270 LEU n 1 271 GLU n 1 272 ASP n 1 273 GLY n 1 274 ILE n 1 275 THR n 1 276 PHE n 1 277 PRO n 1 278 LYS n 1 279 ASP n 1 280 ALA n 1 281 PRO n 1 282 SER n 1 283 PRO n 1 284 PHE n 1 285 ILE n 1 286 PHE n 1 287 LYS n 1 288 THR n 1 289 LEU n 1 290 GLU n 1 291 GLU n 1 292 GLN n 1 293 GLY n 1 294 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene CCP _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle MITOCHONDRIA _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location MITOCHONDRIA _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene 'CCP (MKT)' _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location CYTOPLASM _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PT7CCP _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CCPR_YEAST _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00431 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MTTAVRLLPSLGRTAHKRSLYLFSAAAAAAAAATFAYSQSQKRSSSSPGGGSNHGWNNWGKAAALASTTPLVHVASVEKG RSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFNDPSNAGLQNGFKFLE PIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMG AHALGKTHLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGYMMLPTDYSLIQDPKYLSIVKEYAN DQDKFFKDFSKAFEKLLENGITFPKDAPSPFIFKTLEEQGL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1AEU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 294 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00431 _struct_ref_seq.db_align_beg 71 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 361 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 294 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1AEU ILE A 53 ? UNP P00431 THR 120 variant 53 1 1 1AEU GLY A 152 ? UNP P00431 ASP 219 variant 152 2 1 1AEU GLY A 191 ? UNP P00431 TRP 258 'engineered mutation' 191 3 1 1AEU ASP A 272 ? UNP P00431 ASN 339 conflict 272 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 2MZ non-polymer . 2-METHYLIMIDAZOLE ? 'C4 H6 N2' 82.104 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1AEU _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.2 _exptl_crystal.density_percent_sol 61. _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;20% MPD, 40 MM PHOSPHATE PH 6.0. A SINGLE CRYSTAL OF W191G WAS SOAKED IN 50MM 2-METHYLIMIDAZOLE IN 40% MPD AND 60 MM PHOSPHATE AT PH 4.5. ; # _diffrn.id 1 _diffrn.ambient_temp 290 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'AREA DETECTOR' _diffrn_detector.type SIEMENS _diffrn_detector.pdbx_collection_date 1993-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH2R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1AEU _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 15. _reflns.d_resolution_high 2.1 _reflns.number_obs 16651 _reflns.number_all ? _reflns.percent_possible_obs 58. _reflns.pdbx_Rmerge_I_obs 0.0530000 _reflns.pdbx_Rsym_value 0.0440000 _reflns.pdbx_netI_over_sigmaI 21.3 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 1.5 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.01 _reflns_shell.d_res_low 2.20 _reflns_shell.percent_possible_all 61. _reflns_shell.Rmerge_I_obs 0.1100000 _reflns_shell.pdbx_Rsym_value 0.2200000 _reflns_shell.meanI_over_sigI_obs 2.2 _reflns_shell.pdbx_redundancy 1.4 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1AEU _refine.ls_number_reflns_obs 19099 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 10000000.0 _refine.pdbx_data_cutoff_low_absF 0.5 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 7.0 _refine.ls_d_res_high 2.1 _refine.ls_percent_reflns_obs 79. _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1CMQ' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2841 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 49 _refine_hist.number_atoms_solvent 49 _refine_hist.number_atoms_total 2939 _refine_hist.d_res_high 2.1 _refine_hist.d_res_low 7.0 # _struct.entry_id 1AEU _struct.title 'SPECIFICITY OF LIGAND BINDING IN A POLAR CAVITY OF CYTOCHROME C PEROXIDASE (2-METHYLIMIDAZOLE)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1AEU _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'OXIDOREDUCTASE, PEROXIDASE, TRANSIT PEPTIDE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 A SER A 15 ? ASP A 33 ? SER A 15 ASP A 33 1 ? 19 HELX_P HELX_P2 B TYR A 42 ? SER A 54 ? TYR A 42 SER A 54 1 ? 13 HELX_P HELX_P3 B1 PHE A 73 ? ASN A 78 ? PHE A 73 ASN A 78 1 ? 6 HELX_P HELX_P4 C GLY A 84 ? PHE A 99 ? GLY A 84 PHE A 99 1 ? 16 HELX_P HELX_P5 D SER A 103 ? MET A 119 ? SER A 103 MET A 119 1 ? 17 HELX_P HELX_P6 E ASP A 150 ? PHE A 158 ? ASP A 150 PHE A 158 1 ? 9 HELX_P HELX_P7 F ASN A 164 ? LEU A 177 ? ASN A 164 LEU A 177 1 ? 14 HELX_P HELX_P8 F1 HIS A 181 ? GLY A 186 ? HIS A 181 GLY A 186 1 ? 6 HELX_P HELX_P9 G GLU A 201 ? GLU A 209 ? GLU A 201 GLU A 209 1 ? 9 HELX_P HELX_P10 H LEU A 232 ? GLN A 240 ? LEU A 232 GLN A 240 1 ? 9 HELX_P HELX_P11 I ASP A 241 ? ASN A 253 ? ASP A 241 ASN A 253 1 ? 13 HELX_P HELX_P12 J GLN A 255 ? ASP A 272 ? GLN A 255 ASP A 272 1 ? 18 HELX_P HELX_P13 J1 THR A 288 ? GLY A 293 ? THR A 288 GLY A 293 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 175 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 175 A HEM 295 1_555 ? ? ? ? ? ? ? 2.004 ? ? metalc2 metalc ? ? B HEM . FE ? ? ? 1_555 D HOH . O ? ? A HEM 295 A HOH 313 1_555 ? ? ? ? ? ? ? 2.016 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 211 ? LYS A 215 ? TRP A 211 LYS A 215 A 2 GLU A 221 ? SER A 225 ? GLU A 221 SER A 225 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 212 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 212 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id ASP _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 224 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id ASP _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 224 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AVE Unknown ? ? ? ? 3 'REMOVAL OF TRP 191 FORMS AN INTERNAL CAVITY BELOW THE HEME RELATIVE TO THE ACTIVE SITE.' AC1 Software A HEM 295 ? 19 'BINDING SITE FOR RESIDUE HEM A 295' AC2 Software A 2MZ 296 ? 8 'BINDING SITE FOR RESIDUE 2MZ A 296' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AVE 3 ARG A 48 ? ARG A 48 . ? 1_555 ? 2 AVE 3 TRP A 51 ? TRP A 51 . ? 1_555 ? 3 AVE 3 HIS A 52 ? HIS A 52 . ? 1_555 ? 4 AC1 19 PRO A 44 ? PRO A 44 . ? 1_555 ? 5 AC1 19 VAL A 47 ? VAL A 47 . ? 1_555 ? 6 AC1 19 TRP A 51 ? TRP A 51 . ? 1_555 ? 7 AC1 19 PRO A 145 ? PRO A 145 . ? 1_555 ? 8 AC1 19 ASP A 146 ? ASP A 146 . ? 1_555 ? 9 AC1 19 LEU A 171 ? LEU A 171 . ? 1_555 ? 10 AC1 19 ALA A 174 ? ALA A 174 . ? 1_555 ? 11 AC1 19 HIS A 175 ? HIS A 175 . ? 1_555 ? 12 AC1 19 LEU A 177 ? LEU A 177 . ? 1_555 ? 13 AC1 19 GLY A 178 ? GLY A 178 . ? 1_555 ? 14 AC1 19 LYS A 179 ? LYS A 179 . ? 1_555 ? 15 AC1 19 HIS A 181 ? HIS A 181 . ? 1_555 ? 16 AC1 19 ASN A 184 ? ASN A 184 . ? 1_555 ? 17 AC1 19 SER A 185 ? SER A 185 . ? 1_555 ? 18 AC1 19 2MZ C . ? 2MZ A 296 . ? 1_555 ? 19 AC1 19 HOH D . ? HOH A 302 . ? 1_555 ? 20 AC1 19 HOH D . ? HOH A 311 . ? 1_555 ? 21 AC1 19 HOH D . ? HOH A 313 . ? 1_555 ? 22 AC1 19 HOH D . ? HOH A 314 . ? 1_555 ? 23 AC2 8 HIS A 175 ? HIS A 175 . ? 1_555 ? 24 AC2 8 THR A 180 ? THR A 180 . ? 1_555 ? 25 AC2 8 GLY A 191 ? GLY A 191 . ? 1_555 ? 26 AC2 8 MET A 230 ? MET A 230 . ? 1_555 ? 27 AC2 8 LEU A 232 ? LEU A 232 . ? 1_555 ? 28 AC2 8 ASP A 235 ? ASP A 235 . ? 1_555 ? 29 AC2 8 HEM B . ? HEM A 295 . ? 1_555 ? 30 AC2 8 HOH D . ? HOH A 308 . ? 1_555 ? # _database_PDB_matrix.entry_id 1AEU _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1AEU _atom_sites.fract_transf_matrix[1][1] 0.009506 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013459 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022026 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LYS 2 2 ? ? ? A . n A 1 3 THR 3 3 ? ? ? A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 TRP 101 101 101 TRP TRP A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 MET 119 119 119 MET MET A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 PRO 122 122 122 PRO PRO A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 TRP 126 126 126 TRP TRP A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 CYS 128 128 128 CYS CYS A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 TYR 153 153 153 TYR TYR A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 PHE 157 157 157 PHE PHE A . n A 1 158 PHE 158 158 158 PHE PHE A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 MET 163 163 163 MET MET A . n A 1 164 ASN 164 164 164 ASN ASN A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 MET 172 172 172 MET MET A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 HIS 175 175 175 HIS HIS A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 HIS 181 181 181 HIS HIS A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 ASN 184 184 184 ASN ASN A . n A 1 185 SER 185 185 185 SER SER A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 TYR 187 187 187 TYR TYR A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 PRO 190 190 190 PRO PRO A . n A 1 191 GLY 191 191 191 GLY GLY A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 ALA 194 194 194 ALA ALA A . n A 1 195 ASN 195 195 195 ASN ASN A . n A 1 196 ASN 196 196 196 ASN ASN A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 PHE 198 198 198 PHE PHE A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 ASN 200 200 200 ASN ASN A . n A 1 201 GLU 201 201 201 GLU GLU A . n A 1 202 PHE 202 202 202 PHE PHE A . n A 1 203 TYR 203 203 203 TYR TYR A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 ASN 205 205 205 ASN ASN A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 ASN 208 208 208 ASN ASN A . n A 1 209 GLU 209 209 209 GLU GLU A . n A 1 210 ASP 210 210 210 ASP ASP A . n A 1 211 TRP 211 211 211 TRP TRP A . n A 1 212 LYS 212 212 212 LYS LYS A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 GLU 214 214 214 GLU GLU A . n A 1 215 LYS 215 215 215 LYS LYS A . n A 1 216 ASN 216 216 216 ASN ASN A . n A 1 217 ASP 217 217 217 ASP ASP A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 ASN 219 219 219 ASN ASN A . n A 1 220 ASN 220 220 220 ASN ASN A . n A 1 221 GLU 221 221 221 GLU GLU A . n A 1 222 GLN 222 222 222 GLN GLN A . n A 1 223 TRP 223 223 223 TRP TRP A . n A 1 224 ASP 224 224 224 ASP ASP A . n A 1 225 SER 225 225 225 SER SER A . n A 1 226 LYS 226 226 226 LYS LYS A . n A 1 227 SER 227 227 227 SER SER A . n A 1 228 GLY 228 228 228 GLY GLY A . n A 1 229 TYR 229 229 229 TYR TYR A . n A 1 230 MET 230 230 230 MET MET A . n A 1 231 MET 231 231 231 MET MET A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 PRO 233 233 233 PRO PRO A . n A 1 234 THR 234 234 234 THR THR A . n A 1 235 ASP 235 235 235 ASP ASP A . n A 1 236 TYR 236 236 236 TYR TYR A . n A 1 237 SER 237 237 237 SER SER A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 ILE 239 239 239 ILE ILE A . n A 1 240 GLN 240 240 240 GLN GLN A . n A 1 241 ASP 241 241 241 ASP ASP A . n A 1 242 PRO 242 242 242 PRO PRO A . n A 1 243 LYS 243 243 243 LYS LYS A . n A 1 244 TYR 244 244 244 TYR TYR A . n A 1 245 LEU 245 245 245 LEU LEU A . n A 1 246 SER 246 246 246 SER SER A . n A 1 247 ILE 247 247 247 ILE ILE A . n A 1 248 VAL 248 248 248 VAL VAL A . n A 1 249 LYS 249 249 249 LYS LYS A . n A 1 250 GLU 250 250 250 GLU GLU A . n A 1 251 TYR 251 251 251 TYR TYR A . n A 1 252 ALA 252 252 252 ALA ALA A . n A 1 253 ASN 253 253 253 ASN ASN A . n A 1 254 ASP 254 254 254 ASP ASP A . n A 1 255 GLN 255 255 255 GLN GLN A . n A 1 256 ASP 256 256 256 ASP ASP A . n A 1 257 LYS 257 257 257 LYS LYS A . n A 1 258 PHE 258 258 258 PHE PHE A . n A 1 259 PHE 259 259 259 PHE PHE A . n A 1 260 LYS 260 260 260 LYS LYS A . n A 1 261 ASP 261 261 261 ASP ASP A . n A 1 262 PHE 262 262 262 PHE PHE A . n A 1 263 SER 263 263 263 SER SER A . n A 1 264 LYS 264 264 264 LYS LYS A . n A 1 265 ALA 265 265 265 ALA ALA A . n A 1 266 PHE 266 266 266 PHE PHE A . n A 1 267 GLU 267 267 267 GLU GLU A . n A 1 268 LYS 268 268 268 LYS LYS A . n A 1 269 LEU 269 269 269 LEU LEU A . n A 1 270 LEU 270 270 270 LEU LEU A . n A 1 271 GLU 271 271 271 GLU GLU A . n A 1 272 ASP 272 272 272 ASP ASP A . n A 1 273 GLY 273 273 273 GLY GLY A . n A 1 274 ILE 274 274 274 ILE ILE A . n A 1 275 THR 275 275 275 THR THR A . n A 1 276 PHE 276 276 276 PHE PHE A . n A 1 277 PRO 277 277 277 PRO PRO A . n A 1 278 LYS 278 278 278 LYS LYS A . n A 1 279 ASP 279 279 279 ASP ASP A . n A 1 280 ALA 280 280 280 ALA ALA A . n A 1 281 PRO 281 281 281 PRO PRO A . n A 1 282 SER 282 282 282 SER SER A . n A 1 283 PRO 283 283 283 PRO PRO A . n A 1 284 PHE 284 284 284 PHE PHE A . n A 1 285 ILE 285 285 285 ILE ILE A . n A 1 286 PHE 286 286 286 PHE PHE A . n A 1 287 LYS 287 287 287 LYS LYS A . n A 1 288 THR 288 288 288 THR THR A . n A 1 289 LEU 289 289 289 LEU LEU A . n A 1 290 GLU 290 290 290 GLU GLU A . n A 1 291 GLU 291 291 291 GLU GLU A . n A 1 292 GLN 292 292 292 GLN GLN A . n A 1 293 GLY 293 293 293 GLY GLY A . n A 1 294 LEU 294 294 294 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEM 1 295 1 HEM HEM A . C 3 2MZ 1 296 2 2MZ 2MZ A . D 4 HOH 1 300 300 HOH HOH A . D 4 HOH 2 301 301 HOH HOH A . D 4 HOH 3 302 302 HOH HOH A . D 4 HOH 4 304 304 HOH HOH A . D 4 HOH 5 305 305 HOH HOH A . D 4 HOH 6 306 306 HOH HOH A . D 4 HOH 7 307 307 HOH HOH A . D 4 HOH 8 308 308 HOH HOH A . D 4 HOH 9 309 309 HOH HOH A . D 4 HOH 10 310 310 HOH HOH A . D 4 HOH 11 311 311 HOH HOH A . D 4 HOH 12 312 312 HOH HOH A . D 4 HOH 13 313 313 HOH HOH A . D 4 HOH 14 314 314 HOH HOH A . D 4 HOH 15 315 315 HOH HOH A . D 4 HOH 16 316 316 HOH HOH A . D 4 HOH 17 317 317 HOH HOH A . D 4 HOH 18 318 318 HOH HOH A . D 4 HOH 19 319 319 HOH HOH A . D 4 HOH 20 320 320 HOH HOH A . D 4 HOH 21 321 321 HOH HOH A . D 4 HOH 22 322 322 HOH HOH A . D 4 HOH 23 323 323 HOH HOH A . D 4 HOH 24 324 324 HOH HOH A . D 4 HOH 25 325 325 HOH HOH A . D 4 HOH 26 326 326 HOH HOH A . D 4 HOH 27 327 327 HOH HOH A . D 4 HOH 28 328 328 HOH HOH A . D 4 HOH 29 329 329 HOH HOH A . D 4 HOH 30 330 330 HOH HOH A . D 4 HOH 31 331 331 HOH HOH A . D 4 HOH 32 332 332 HOH HOH A . D 4 HOH 33 333 333 HOH HOH A . D 4 HOH 34 334 334 HOH HOH A . D 4 HOH 35 335 335 HOH HOH A . D 4 HOH 36 336 336 HOH HOH A . D 4 HOH 37 337 337 HOH HOH A . D 4 HOH 38 338 338 HOH HOH A . D 4 HOH 39 339 339 HOH HOH A . D 4 HOH 40 340 340 HOH HOH A . D 4 HOH 41 341 341 HOH HOH A . D 4 HOH 42 342 342 HOH HOH A . D 4 HOH 43 344 344 HOH HOH A . D 4 HOH 44 345 345 HOH HOH A . D 4 HOH 45 346 346 HOH HOH A . D 4 HOH 46 347 347 HOH HOH A . D 4 HOH 47 348 348 HOH HOH A . D 4 HOH 48 349 349 HOH HOH A . D 4 HOH 49 350 350 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 175 ? A HIS 175 ? 1_555 FE ? B HEM . ? A HEM 295 ? 1_555 NA ? B HEM . ? A HEM 295 ? 1_555 94.1 ? 2 NE2 ? A HIS 175 ? A HIS 175 ? 1_555 FE ? B HEM . ? A HEM 295 ? 1_555 NB ? B HEM . ? A HEM 295 ? 1_555 93.4 ? 3 NA ? B HEM . ? A HEM 295 ? 1_555 FE ? B HEM . ? A HEM 295 ? 1_555 NB ? B HEM . ? A HEM 295 ? 1_555 90.2 ? 4 NE2 ? A HIS 175 ? A HIS 175 ? 1_555 FE ? B HEM . ? A HEM 295 ? 1_555 NC ? B HEM . ? A HEM 295 ? 1_555 87.7 ? 5 NA ? B HEM . ? A HEM 295 ? 1_555 FE ? B HEM . ? A HEM 295 ? 1_555 NC ? B HEM . ? A HEM 295 ? 1_555 178.0 ? 6 NB ? B HEM . ? A HEM 295 ? 1_555 FE ? B HEM . ? A HEM 295 ? 1_555 NC ? B HEM . ? A HEM 295 ? 1_555 88.9 ? 7 NE2 ? A HIS 175 ? A HIS 175 ? 1_555 FE ? B HEM . ? A HEM 295 ? 1_555 ND ? B HEM . ? A HEM 295 ? 1_555 89.6 ? 8 NA ? B HEM . ? A HEM 295 ? 1_555 FE ? B HEM . ? A HEM 295 ? 1_555 ND ? B HEM . ? A HEM 295 ? 1_555 89.6 ? 9 NB ? B HEM . ? A HEM 295 ? 1_555 FE ? B HEM . ? A HEM 295 ? 1_555 ND ? B HEM . ? A HEM 295 ? 1_555 177.0 ? 10 NC ? B HEM . ? A HEM 295 ? 1_555 FE ? B HEM . ? A HEM 295 ? 1_555 ND ? B HEM . ? A HEM 295 ? 1_555 91.1 ? 11 NE2 ? A HIS 175 ? A HIS 175 ? 1_555 FE ? B HEM . ? A HEM 295 ? 1_555 O ? D HOH . ? A HOH 313 ? 1_555 170.4 ? 12 NA ? B HEM . ? A HEM 295 ? 1_555 FE ? B HEM . ? A HEM 295 ? 1_555 O ? D HOH . ? A HOH 313 ? 1_555 76.7 ? 13 NB ? B HEM . ? A HEM 295 ? 1_555 FE ? B HEM . ? A HEM 295 ? 1_555 O ? D HOH . ? A HOH 313 ? 1_555 84.1 ? 14 NC ? B HEM . ? A HEM 295 ? 1_555 FE ? B HEM . ? A HEM 295 ? 1_555 O ? D HOH . ? A HOH 313 ? 1_555 101.4 ? 15 ND ? B HEM . ? A HEM 295 ? 1_555 FE ? B HEM . ? A HEM 295 ? 1_555 O ? D HOH . ? A HOH 313 ? 1_555 93.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-09-04 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 5 'Structure model' 1 4 2023-08-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' struct_conn 3 4 'Structure model' struct_ref_seq_dif 4 4 'Structure model' struct_site 5 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 4 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 5 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 6 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 9 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 15 4 'Structure model' '_struct_ref_seq_dif.details' 16 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 17 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 18 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal XTALVIEW refinement . ? 1 XENGEN 'data reduction' . ? 2 XENGEN 'data scaling' . ? 3 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 HG1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 THR _pdbx_validate_close_contact.auth_seq_id_1 63 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HH12 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 143 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.19 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 NE2 A HIS 60 ? ? CD2 A HIS 60 ? ? 1.302 1.373 -0.071 0.011 N 2 1 NE2 A HIS 96 ? ? CD2 A HIS 96 ? ? 1.304 1.373 -0.069 0.011 N 3 1 NE2 A HIS 175 ? ? CD2 A HIS 175 ? ? 1.305 1.373 -0.068 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 125.02 120.30 4.72 0.50 N 2 1 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH2 A ARG 31 ? ? 113.73 120.30 -6.57 0.50 N 3 1 NE A ARG 48 ? ? CZ A ARG 48 ? ? NH1 A ARG 48 ? ? 125.70 120.30 5.40 0.50 N 4 1 CD1 A TRP 51 ? ? CG A TRP 51 ? ? CD2 A TRP 51 ? ? 112.88 106.30 6.58 0.80 N 5 1 CE2 A TRP 51 ? ? CD2 A TRP 51 ? ? CG A TRP 51 ? ? 101.64 107.30 -5.66 0.80 N 6 1 CD1 A TRP 57 ? ? CG A TRP 57 ? ? CD2 A TRP 57 ? ? 111.46 106.30 5.16 0.80 N 7 1 CE2 A TRP 57 ? ? CD2 A TRP 57 ? ? CG A TRP 57 ? ? 101.28 107.30 -6.02 0.80 N 8 1 CD1 A TRP 101 ? ? CG A TRP 101 ? ? CD2 A TRP 101 ? ? 112.42 106.30 6.12 0.80 N 9 1 CE2 A TRP 101 ? ? CD2 A TRP 101 ? ? CG A TRP 101 ? ? 101.69 107.30 -5.61 0.80 N 10 1 CD1 A TRP 126 ? ? CG A TRP 126 ? ? CD2 A TRP 126 ? ? 111.82 106.30 5.52 0.80 N 11 1 CE2 A TRP 126 ? ? CD2 A TRP 126 ? ? CG A TRP 126 ? ? 101.24 107.30 -6.06 0.80 N 12 1 NE A ARG 127 ? ? CZ A ARG 127 ? ? NH1 A ARG 127 ? ? 124.54 120.30 4.24 0.50 N 13 1 NE A ARG 127 ? ? CZ A ARG 127 ? ? NH2 A ARG 127 ? ? 115.40 120.30 -4.90 0.50 N 14 1 NE A ARG 143 ? ? CZ A ARG 143 ? ? NH2 A ARG 143 ? ? 115.56 120.30 -4.74 0.50 N 15 1 CA A ASN 162 ? ? C A ASN 162 ? ? N A MET 163 ? ? 101.56 117.20 -15.64 2.20 Y 16 1 CG A MET 163 ? ? SD A MET 163 ? ? CE A MET 163 ? ? 83.78 100.20 -16.42 1.60 N 17 1 CD1 A TRP 211 ? ? CG A TRP 211 ? ? CD2 A TRP 211 ? ? 111.46 106.30 5.16 0.80 N 18 1 CE2 A TRP 211 ? ? CD2 A TRP 211 ? ? CG A TRP 211 ? ? 102.33 107.30 -4.97 0.80 N 19 1 CD1 A TRP 223 ? ? CG A TRP 223 ? ? CD2 A TRP 223 ? ? 113.20 106.30 6.90 0.80 N 20 1 CE2 A TRP 223 ? ? CD2 A TRP 223 ? ? CG A TRP 223 ? ? 100.94 107.30 -6.36 0.80 N 21 1 CB A TYR 229 ? ? CG A TYR 229 ? ? CD2 A TYR 229 ? ? 115.69 121.00 -5.31 0.60 N 22 1 CA A LYS 278 ? ? CB A LYS 278 ? ? CG A LYS 278 ? ? 98.45 113.40 -14.95 2.20 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 33 ? ? -89.83 45.61 2 1 ASN A 62 ? ? 56.32 19.01 3 1 ASP A 148 ? ? -83.11 45.07 4 1 ASN A 162 ? ? 10.85 66.55 5 1 ASN A 196 ? ? -146.13 26.21 6 1 ASN A 219 ? ? 80.04 21.76 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 72 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.077 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 12 ? NZ ? A LYS 12 NZ 2 1 Y 1 A LYS 260 ? NZ ? A LYS 260 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LYS 2 ? A LYS 2 3 1 Y 1 A THR 3 ? A THR 3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PROTOPORPHYRIN IX CONTAINING FE' HEM 3 2-METHYLIMIDAZOLE 2MZ 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1CMQ _pdbx_initial_refinement_model.details 'PDB ENTRY 1CMQ' #