data_1AEY # _entry.id 1AEY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1AEY pdb_00001aey 10.2210/pdb1aey/pdb WWPDB D_1000170733 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1AEY _pdbx_database_status.recvd_initial_deposition_date 1997-03-02 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Blanco, F.J.' 1 'Ortiz, A.R.' 2 'Serrano, L.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;1H and 15N NMR assignment and solution structure of the SH3 domain of spectrin: comparison of unrefined and refined structure sets with the crystal structure. ; J.Biomol.NMR 9 347 357 1997 JBNME9 NE 0925-2738 0800 ? 9255941 10.1023/A:1018330122908 1 'Different Folding Transition States May Result in the Same Native Structure' Nat.Struct.Biol. 3 874 ? 1996 NSBIEW US 1072-8368 2024 ? ? ? 2 'Crystal Structure of a Src-Homology 3 (SH3) Domain' Nature 359 851 ? 1992 NATUAS UK 0028-0836 0006 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Blanco, F.J.' 1 ? primary 'Ortiz, A.R.' 2 ? primary 'Serrano, L.' 3 ? 1 'Viguera, A.R.' 4 ? 1 'Serrano, L.' 5 ? 1 'Wilmanns, M.' 6 ? 2 'Musacchio, A.' 7 ? 2 'Noble, M.' 8 ? 2 'Pauptit, R.' 9 ? 2 'Wierenga, R.' 10 ? 2 'Saraste, M.' 11 ? # _cell.entry_id 1AEY _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1AEY _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description ALPHA-SPECTRIN _entity.formula_weight 7229.244 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SRC HOMOLOGY 3 DOMAIN' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD _entity_poly.pdbx_seq_one_letter_code_can MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 GLU n 1 4 THR n 1 5 GLY n 1 6 LYS n 1 7 GLU n 1 8 LEU n 1 9 VAL n 1 10 LEU n 1 11 ALA n 1 12 LEU n 1 13 TYR n 1 14 ASP n 1 15 TYR n 1 16 GLN n 1 17 GLU n 1 18 LYS n 1 19 SER n 1 20 PRO n 1 21 ARG n 1 22 GLU n 1 23 VAL n 1 24 THR n 1 25 MET n 1 26 LYS n 1 27 LYS n 1 28 GLY n 1 29 ASP n 1 30 ILE n 1 31 LEU n 1 32 THR n 1 33 LEU n 1 34 LEU n 1 35 ASN n 1 36 SER n 1 37 THR n 1 38 ASN n 1 39 LYS n 1 40 ASP n 1 41 TRP n 1 42 TRP n 1 43 LYS n 1 44 VAL n 1 45 GLU n 1 46 VAL n 1 47 ASN n 1 48 ASP n 1 49 ARG n 1 50 GLN n 1 51 GLY n 1 52 PHE n 1 53 VAL n 1 54 PRO n 1 55 ALA n 1 56 ALA n 1 57 TYR n 1 58 VAL n 1 59 LYS n 1 60 LYS n 1 61 LEU n 1 62 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name chicken _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Gallus gallus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9031 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ BRAIN _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location CYTOSKELETON _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET3D _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SPTA2_CHICK _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P07751 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSSLRRQKLEDSYRFQFFQRDADELGKWIQEKLQIASDENYKDPSNLQG KLQKHQAFEAEVQANSGAIVKLDETGNQMINEGHFASETIRTRLQELHRLWELLLEKMREKGVKLLQAQKLVQFLRECED VMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDLAAHEERVNEVNQFAGKLIQEQHPEEELIKSKQDEVNASWQRL KGLAQQRQGKLFGAAEVQRFNRDVDETISWIKEKGQLMASDDFGRDLASVQALLRKHEGLERDLAAFHHKVKALCAEADR LQQSHPINASQIQVKREELIANWEQIRTLAAERHARLNDSYRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALL DRHQEHKGEIDAHEDSFRSADESGQALLAAGHYASDEVKEKLTILSDERSALLELWELRRQQYEQCMDLQLFYRDTEQVD NWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMDDVATRRDALLSRRNALHE RAMKRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLID VNHYASDEVAARMNEVISLWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTSVQNLQKKH ALLEADVAAHQDPIDGITIQARQFQDAGHFDADNIKKKQEALVARYEALKDPMVARKQKLADSLRLQQLFRDIEDEETWI REKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKIKLNELNQKWDSLKAKAS QRRQDLEDSLQAQQYFADANEAQSWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQV APTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDPAQSASRENLLEEQG SIALRQEQIDNQTLITKEVGSVSLRMKQVEELYHSLLELGEKRKGMLEKSCKKFMLFREANELQQWINEKEAALTNEEVG ADLEQVEVLQKKFDDFQKDLKANESRLKDINKVANDLESEGLMAEEVQAVEHQEVYGMMPRDETDSKTVSPWKSARMMVH TVATFNSIKELNERWRSLQQLAEERSQLLGSADEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRNDEGFER DLAALGDKVNSLGETAQRLIQSHPELAEDLQEKCTELNQAWSSLGKRADQRKEKLGDSHDLQRFLSDFRDLMSWINGIRG LVSSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLARGHYASPEIKEKLDILDQERTDLEKAWVQRRMM LDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAVLQSFADQLIAADHYAKG VIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDVDEIEAWISEKLQTASDESYKDPTNIQLSKLLSKHQKHQAF EAELHANADRIRGVIEMGNPLIERGACAGSEDAVKARLAALADQWEFLVQKSSEKSQKLKEANKQQNFNTGIKDFDFWLS EVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRETINGRFQRIKSMAAA RRAKLNESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNT IGKEEIQQRLAQFVDHWKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAF ETDFTVHKDRVNDVCANGEDLIKKNNHHVENITAKMKGLKGKVSDLEKAAAQRKAKLDENSAFLQFNWKADVVESWIGEK ENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHIQSKAIEVRHASLMKRWNQLLANSAAR KKKLLEAQEHFRKVEDLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDR QIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQWIQETRTYLLDGSCMV EESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQAR NTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFESILDTVDPNRDGHVSLQEYMAFM ISRETENVKSSEEIESAFRALSSERKPYVTKEELYQNLTREQADYCISHMKPYMDGKGRELPSAYDYIEFTRSLFVN ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1AEY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 62 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07751 _struct_ref_seq.db_align_beg 965 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1025 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 62 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 TOCSY 1 3 1 COSY 1 4 1 HMQC-TOCSY 1 5 1 HMQC-NOESY 1 6 1 E.COSY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 297 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 3.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AMX500 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1AEY _pdbx_nmr_refine.method 'VARIABLE TARGET FUNCTION SIMULATED ANNEALING' _pdbx_nmr_refine.details 'THE FINAL MODELS WERE ENERGY MINIMIZED IN A SHELL OF WATER MOLECULES USING THE AMBER ALL ATOM FORCE FIELD.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1AEY _pdbx_nmr_ensemble.conformers_calculated_total_number 15 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement Amber 4.1 'PEARLMAN,CASE,CALDWELL,ROSS,CHEATHAM, FERGUSON,SEIBEL,SINGH,WEINER,KOLLMAN' 1 'structure solution' UXNMR ? ? 2 'structure solution' AURELIA ? ? 3 'structure solution' DIANA ? ? 4 'structure solution' Amber ? ? 5 # _exptl.entry_id 1AEY _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1AEY _struct.title 'ALPHA-SPECTRIN SRC HOMOLOGY 3 DOMAIN, SOLUTION NMR, 15 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1AEY _struct_keywords.pdbx_keywords CYTOSKELETON _struct_keywords.text 'CYTOSKELETON, CAPPING PROTEIN, CALCIUM-BINDING, DUPLICATION, SH3 DOMAIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 55 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TYR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 57 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 55 _struct_conf.end_auth_comp_id TYR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 57 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 58 ? ASP A 62 ? VAL A 58 ASP A 62 A 2 GLU A 7 ? ALA A 11 ? GLU A 7 ALA A 11 A 3 ILE A 30 ? ASN A 35 ? ILE A 30 ASN A 35 A 4 TRP A 41 ? VAL A 46 ? TRP A 41 VAL A 46 A 5 ARG A 49 ? PRO A 54 ? ARG A 49 PRO A 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 59 ? O LYS A 59 N LEU A 10 ? N LEU A 10 A 2 3 O GLU A 7 ? O GLU A 7 N LEU A 33 ? N LEU A 33 A 3 4 O THR A 32 ? O THR A 32 N GLU A 45 ? N GLU A 45 A 4 5 O TRP A 42 ? O TRP A 42 N VAL A 53 ? N VAL A 53 # _database_PDB_matrix.entry_id 1AEY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1AEY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASP 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 TRP 41 41 41 TRP TRP A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ASP 62 62 62 ASP ASP A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-05-15 2 'Structure model' 1 1 2008-03-26 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_software.name' # _software.name AMBER _software.classification refinement _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 15 CB A ASP 48 ? ? CA A ASP 48 ? ? C A ASP 48 ? ? 97.61 110.40 -12.79 2.00 N 2 15 N A ARG 49 ? ? CA A ARG 49 ? ? CB A ARG 49 ? ? 98.80 110.60 -11.80 1.80 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 6 ? ? -76.87 -142.17 2 1 LYS A 39 ? ? 75.25 -51.00 3 1 ASN A 47 ? ? 60.12 -72.85 4 1 ASP A 48 ? ? -150.93 11.59 5 2 LYS A 6 ? ? -70.92 -125.94 6 2 LEU A 34 ? ? -98.11 -66.53 7 2 ASP A 40 ? ? -130.22 -53.13 8 2 ASN A 47 ? ? 65.11 -80.81 9 3 LYS A 6 ? ? -109.75 -153.49 10 3 SER A 36 ? ? -84.30 49.44 11 3 ASN A 47 ? ? 61.46 -77.93 12 4 GLU A 17 ? ? -47.14 152.08 13 4 ASP A 40 ? ? -107.74 -65.35 14 4 ASN A 47 ? ? 63.93 -76.46 15 5 SER A 36 ? ? -116.61 53.12 16 5 ASN A 47 ? ? 65.70 -86.56 17 6 LYS A 6 ? ? 58.68 95.34 18 6 SER A 36 ? ? -109.41 43.82 19 6 THR A 37 ? ? -88.73 37.76 20 6 ASN A 47 ? ? 62.98 -74.34 21 6 ASP A 48 ? ? -160.18 22.34 22 7 LYS A 6 ? ? -104.67 -152.99 23 7 ASN A 47 ? ? 67.49 -71.25 24 8 LYS A 6 ? ? -81.93 -140.14 25 8 ASP A 40 ? ? -152.86 -61.13 26 8 ASN A 47 ? ? 67.07 -69.08 27 8 ASP A 48 ? ? -154.04 15.27 28 9 THR A 37 ? ? -61.43 1.69 29 9 LYS A 39 ? ? 72.61 -59.89 30 9 ASP A 40 ? ? -90.43 -64.27 31 9 ASN A 47 ? ? 61.28 -85.53 32 10 LYS A 6 ? ? 59.66 95.73 33 10 GLU A 17 ? ? -39.63 132.67 34 10 ASN A 47 ? ? 58.18 -88.71 35 10 LEU A 61 ? ? -93.37 38.77 36 11 ASN A 47 ? ? 67.05 -74.99 37 12 ASN A 47 ? ? 71.36 -63.16 38 12 ASP A 48 ? ? -153.35 -1.45 39 12 GLN A 50 ? ? -101.10 76.92 40 13 LEU A 34 ? ? -146.37 -32.60 41 13 ASP A 40 ? ? -159.17 -52.05 42 13 ASN A 47 ? ? 58.52 -77.11 43 13 LEU A 61 ? ? -96.58 42.25 44 14 LYS A 6 ? ? -158.07 48.25 45 14 LEU A 34 ? ? -79.89 -72.24 46 14 ASN A 47 ? ? 64.79 -71.49 47 14 ASP A 48 ? ? -156.38 22.55 48 15 LYS A 6 ? ? -95.02 58.96 49 15 LEU A 34 ? ? -145.48 -48.89 50 15 SER A 36 ? ? -141.58 25.92 51 15 ASP A 40 ? ? -95.47 -63.47 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 TYR A 13 ? ? 0.062 'SIDE CHAIN' 2 2 TYR A 15 ? ? 0.090 'SIDE CHAIN' 3 2 ARG A 21 ? ? 0.101 'SIDE CHAIN' 4 3 ARG A 21 ? ? 0.107 'SIDE CHAIN' 5 3 ARG A 49 ? ? 0.076 'SIDE CHAIN' 6 4 TYR A 13 ? ? 0.091 'SIDE CHAIN' 7 5 TYR A 15 ? ? 0.067 'SIDE CHAIN' 8 5 ARG A 21 ? ? 0.114 'SIDE CHAIN' 9 7 TYR A 13 ? ? 0.065 'SIDE CHAIN' 10 7 TYR A 15 ? ? 0.079 'SIDE CHAIN' 11 9 TYR A 13 ? ? 0.070 'SIDE CHAIN' 12 10 TYR A 13 ? ? 0.073 'SIDE CHAIN' 13 11 TYR A 13 ? ? 0.075 'SIDE CHAIN' 14 12 TYR A 15 ? ? 0.093 'SIDE CHAIN' 15 12 ARG A 21 ? ? 0.094 'SIDE CHAIN' 16 12 ARG A 49 ? ? 0.103 'SIDE CHAIN' 17 14 TYR A 15 ? ? 0.109 'SIDE CHAIN' 18 15 TYR A 15 ? ? 0.071 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASP 2 ? A ASP 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A THR 4 ? A THR 4 5 2 Y 1 A MET 1 ? A MET 1 6 2 Y 1 A ASP 2 ? A ASP 2 7 2 Y 1 A GLU 3 ? A GLU 3 8 2 Y 1 A THR 4 ? A THR 4 9 3 Y 1 A MET 1 ? A MET 1 10 3 Y 1 A ASP 2 ? A ASP 2 11 3 Y 1 A GLU 3 ? A GLU 3 12 3 Y 1 A THR 4 ? A THR 4 13 4 Y 1 A MET 1 ? A MET 1 14 4 Y 1 A ASP 2 ? A ASP 2 15 4 Y 1 A GLU 3 ? A GLU 3 16 4 Y 1 A THR 4 ? A THR 4 17 5 Y 1 A MET 1 ? A MET 1 18 5 Y 1 A ASP 2 ? A ASP 2 19 5 Y 1 A GLU 3 ? A GLU 3 20 5 Y 1 A THR 4 ? A THR 4 21 6 Y 1 A MET 1 ? A MET 1 22 6 Y 1 A ASP 2 ? A ASP 2 23 6 Y 1 A GLU 3 ? A GLU 3 24 6 Y 1 A THR 4 ? A THR 4 25 7 Y 1 A MET 1 ? A MET 1 26 7 Y 1 A ASP 2 ? A ASP 2 27 7 Y 1 A GLU 3 ? A GLU 3 28 7 Y 1 A THR 4 ? A THR 4 29 8 Y 1 A MET 1 ? A MET 1 30 8 Y 1 A ASP 2 ? A ASP 2 31 8 Y 1 A GLU 3 ? A GLU 3 32 8 Y 1 A THR 4 ? A THR 4 33 9 Y 1 A MET 1 ? A MET 1 34 9 Y 1 A ASP 2 ? A ASP 2 35 9 Y 1 A GLU 3 ? A GLU 3 36 9 Y 1 A THR 4 ? A THR 4 37 10 Y 1 A MET 1 ? A MET 1 38 10 Y 1 A ASP 2 ? A ASP 2 39 10 Y 1 A GLU 3 ? A GLU 3 40 10 Y 1 A THR 4 ? A THR 4 41 11 Y 1 A MET 1 ? A MET 1 42 11 Y 1 A ASP 2 ? A ASP 2 43 11 Y 1 A GLU 3 ? A GLU 3 44 11 Y 1 A THR 4 ? A THR 4 45 12 Y 1 A MET 1 ? A MET 1 46 12 Y 1 A ASP 2 ? A ASP 2 47 12 Y 1 A GLU 3 ? A GLU 3 48 12 Y 1 A THR 4 ? A THR 4 49 13 Y 1 A MET 1 ? A MET 1 50 13 Y 1 A ASP 2 ? A ASP 2 51 13 Y 1 A GLU 3 ? A GLU 3 52 13 Y 1 A THR 4 ? A THR 4 53 14 Y 1 A MET 1 ? A MET 1 54 14 Y 1 A ASP 2 ? A ASP 2 55 14 Y 1 A GLU 3 ? A GLU 3 56 14 Y 1 A THR 4 ? A THR 4 57 15 Y 1 A MET 1 ? A MET 1 58 15 Y 1 A ASP 2 ? A ASP 2 59 15 Y 1 A GLU 3 ? A GLU 3 60 15 Y 1 A THR 4 ? A THR 4 #