data_1ARR # _entry.id 1ARR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ARR pdb_00001arr 10.2210/pdb1arr/pdb WWPDB D_1000171177 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1ARQ _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ARR _pdbx_database_status.recvd_initial_deposition_date 1993-08-24 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bonvin, A.M.J.J.' 1 'Vis, H.' 2 'Burgering, M.J.M.' 3 'Breg, J.N.' 4 'Boelens, R.' 5 'Kaptein, R.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Nuclear magnetic resonance solution structure of the Arc repressor using relaxation matrix calculations.' J.Mol.Biol. 236 328 341 1994 JMOBAK UK 0022-2836 0070 ? 8107113 10.1006/jmbi.1994.1138 1 'Structure of Arc Repressor in Solution: Evidence for a Family of B-Sheet DNA-Binding Protein' Nature 346 586 ? 1990 NATUAS UK 0028-0836 0006 ? ? ? 2 ;Sequence-Specific 1H NMR Assignment and Secondary Structure of the Arc Repressor of Bacteriophage P22 as Determined by 2D 1H NMR Spectroscopy ; Biochemistry 28 9826 ? 1989 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bonvin, A.M.' 1 ? primary 'Vis, H.' 2 ? primary 'Breg, J.N.' 3 ? primary 'Burgering, M.J.' 4 ? primary 'Boelens, R.' 5 ? primary 'Kaptein, R.' 6 ? 1 'Breg, J.N.' 7 ? 1 'Van Opheusden, J.H.J.' 8 ? 1 'Burgering, M.J.M.' 9 ? 1 'Boelens, R.' 10 ? 1 'Kaptein, R.' 11 ? 2 'Breg, J.N.' 12 ? 2 'Boelens, R.' 13 ? 2 'George, A.V.E.' 14 ? 2 'Kaptein, R.' 15 ? # _cell.entry_id 1ARR _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ARR _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ARC REPRESSOR' _entity.formula_weight 6238.272 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA _entity_poly.pdbx_seq_one_letter_code_can MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 GLY n 1 4 MET n 1 5 SER n 1 6 LYS n 1 7 MET n 1 8 PRO n 1 9 GLN n 1 10 PHE n 1 11 ASN n 1 12 LEU n 1 13 ARG n 1 14 TRP n 1 15 PRO n 1 16 ARG n 1 17 GLU n 1 18 VAL n 1 19 LEU n 1 20 ASP n 1 21 LEU n 1 22 VAL n 1 23 ARG n 1 24 LYS n 1 25 VAL n 1 26 ALA n 1 27 GLU n 1 28 GLU n 1 29 ASN n 1 30 GLY n 1 31 ARG n 1 32 SER n 1 33 VAL n 1 34 ASN n 1 35 SER n 1 36 GLU n 1 37 ILE n 1 38 TYR n 1 39 GLN n 1 40 ARG n 1 41 VAL n 1 42 MET n 1 43 GLU n 1 44 SER n 1 45 PHE n 1 46 LYS n 1 47 LYS n 1 48 GLU n 1 49 GLY n 1 50 ARG n 1 51 ILE n 1 52 GLY n 1 53 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus 'P22-like viruses' _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage P22' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10754 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RARC_BPP22 _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P03050 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1ARR A 1 ? 53 ? P03050 1 ? 53 ? 1 53 2 1 1ARR B 1 ? 53 ? P03050 1 ? 53 ? 1 53 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1ARR _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name IRMA _pdbx_nmr_software.version ? _pdbx_nmr_software.authors ? _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1ARR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1ARR _struct.title 'RELAXATION MATRIX REFINEMENT OF THE SOLUTION STRUCTURE OF THE ARC REPRESSOR' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ARR _struct_keywords.pdbx_keywords 'GENE-REGULATING PROTEIN' _struct_keywords.text 'GENE-REGULATING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 ARG A 16 ? ASN A 29 ? ARG A 16 ASN A 29 1 ? 14 HELX_P HELX_P2 H2 SER A 35 ? LYS A 46 ? SER A 35 LYS A 46 1 ? 12 HELX_P HELX_P3 H3 ARG B 16 ? ASN B 29 ? ARG B 16 ASN B 29 1 ? 14 HELX_P HELX_P4 H4 SER B 35 ? LYS B 46 ? SER B 35 LYS B 46 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id S1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id S1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 PRO A 8 ? TRP A 14 ? PRO A 8 TRP A 14 S1 2 PRO B 8 ? TRP B 14 ? PRO B 8 TRP B 14 # _database_PDB_matrix.entry_id 1ARR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ARR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 TRP 14 14 14 TRP TRP A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ALA 53 53 53 ALA ALA A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 LYS 2 2 2 LYS LYS B . n B 1 3 GLY 3 3 3 GLY GLY B . n B 1 4 MET 4 4 4 MET MET B . n B 1 5 SER 5 5 5 SER SER B . n B 1 6 LYS 6 6 6 LYS LYS B . n B 1 7 MET 7 7 7 MET MET B . n B 1 8 PRO 8 8 8 PRO PRO B . n B 1 9 GLN 9 9 9 GLN GLN B . n B 1 10 PHE 10 10 10 PHE PHE B . n B 1 11 ASN 11 11 11 ASN ASN B . n B 1 12 LEU 12 12 12 LEU LEU B . n B 1 13 ARG 13 13 13 ARG ARG B . n B 1 14 TRP 14 14 14 TRP TRP B . n B 1 15 PRO 15 15 15 PRO PRO B . n B 1 16 ARG 16 16 16 ARG ARG B . n B 1 17 GLU 17 17 17 GLU GLU B . n B 1 18 VAL 18 18 18 VAL VAL B . n B 1 19 LEU 19 19 19 LEU LEU B . n B 1 20 ASP 20 20 20 ASP ASP B . n B 1 21 LEU 21 21 21 LEU LEU B . n B 1 22 VAL 22 22 22 VAL VAL B . n B 1 23 ARG 23 23 23 ARG ARG B . n B 1 24 LYS 24 24 24 LYS LYS B . n B 1 25 VAL 25 25 25 VAL VAL B . n B 1 26 ALA 26 26 26 ALA ALA B . n B 1 27 GLU 27 27 27 GLU GLU B . n B 1 28 GLU 28 28 28 GLU GLU B . n B 1 29 ASN 29 29 29 ASN ASN B . n B 1 30 GLY 30 30 30 GLY GLY B . n B 1 31 ARG 31 31 31 ARG ARG B . n B 1 32 SER 32 32 32 SER SER B . n B 1 33 VAL 33 33 33 VAL VAL B . n B 1 34 ASN 34 34 34 ASN ASN B . n B 1 35 SER 35 35 35 SER SER B . n B 1 36 GLU 36 36 36 GLU GLU B . n B 1 37 ILE 37 37 37 ILE ILE B . n B 1 38 TYR 38 38 38 TYR TYR B . n B 1 39 GLN 39 39 39 GLN GLN B . n B 1 40 ARG 40 40 40 ARG ARG B . n B 1 41 VAL 41 41 41 VAL VAL B . n B 1 42 MET 42 42 42 MET MET B . n B 1 43 GLU 43 43 43 GLU GLU B . n B 1 44 SER 44 44 44 SER SER B . n B 1 45 PHE 45 45 45 PHE PHE B . n B 1 46 LYS 46 46 46 LYS LYS B . n B 1 47 LYS 47 47 47 LYS LYS B . n B 1 48 GLU 48 48 48 GLU GLU B . n B 1 49 GLY 49 49 49 GLY GLY B . n B 1 50 ARG 50 50 50 ARG ARG B . n B 1 51 ILE 51 51 51 ILE ILE B . n B 1 52 GLY 52 52 52 GLY GLY B . n B 1 53 ALA 53 53 53 ALA ALA B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-01-31 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A PHE 10 ? ? CG A PHE 10 ? ? CD2 A PHE 10 ? ? 112.42 120.80 -8.38 0.70 N 2 1 CB A PHE 10 ? ? CG A PHE 10 ? ? CD1 A PHE 10 ? ? 126.12 120.80 5.32 0.70 N 3 1 CB A LEU 12 ? ? CG A LEU 12 ? ? CD2 A LEU 12 ? ? 122.98 111.00 11.98 1.70 N 4 1 N A ARG 16 ? ? CA A ARG 16 ? ? CB A ARG 16 ? ? 122.60 110.60 12.00 1.80 N 5 1 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH1 A ARG 16 ? ? 123.63 120.30 3.33 0.50 N 6 1 CB A LEU 19 ? ? CG A LEU 19 ? ? CD1 A LEU 19 ? ? 123.23 111.00 12.23 1.70 N 7 1 CA A VAL 22 ? ? CB A VAL 22 ? ? CG2 A VAL 22 ? ? 120.38 110.90 9.48 1.50 N 8 1 CA A VAL 25 ? ? CB A VAL 25 ? ? CG2 A VAL 25 ? ? 122.15 110.90 11.25 1.50 N 9 1 CD1 A TYR 38 ? ? CG A TYR 38 ? ? CD2 A TYR 38 ? ? 125.48 117.90 7.58 1.10 N 10 1 CB A TYR 38 ? ? CG A TYR 38 ? ? CD1 A TYR 38 ? ? 107.54 121.00 -13.46 0.60 N 11 1 CB A PHE 45 ? ? CG A PHE 45 ? ? CD2 A PHE 45 ? ? 116.23 120.80 -4.57 0.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 4 ? ? 30.23 62.22 2 1 SER A 5 ? ? -105.07 65.42 3 1 MET A 7 ? ? -151.19 84.73 4 1 ILE A 51 ? ? 20.98 76.00 5 1 SER B 5 ? ? -106.39 52.81 6 1 LYS B 6 ? ? -78.88 42.69 7 1 VAL B 33 ? ? 7.71 -68.70 8 1 LYS B 47 ? ? -89.13 44.72 9 1 GLU B 48 ? ? -32.83 -20.61 10 1 ILE B 51 ? ? 15.69 92.31 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 MET A 4 ? ? -14.77 2 1 LYS A 6 ? ? -10.48 3 1 ARG A 16 ? ? -11.64 4 1 GLU A 17 ? ? -10.48 5 1 LEU A 19 ? ? -11.51 6 1 ASP A 20 ? ? -10.73 7 1 ARG A 23 ? ? -10.94 8 1 ARG A 40 ? ? -11.26 9 1 VAL A 41 ? ? -10.56 10 1 MET B 4 ? ? -13.85 11 1 PRO B 8 ? ? -12.25 12 1 ARG B 16 ? ? -10.97 13 1 VAL B 22 ? ? -10.19 14 1 ARG B 23 ? ? -11.17 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 38 ? ? 0.137 'SIDE CHAIN' 2 1 PHE A 45 ? ? 0.174 'SIDE CHAIN' 3 1 ARG B 13 ? ? 0.138 'SIDE CHAIN' 4 1 TYR B 38 ? ? 0.073 'SIDE CHAIN' 5 1 ARG B 50 ? ? 0.124 'SIDE CHAIN' # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id CA _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id ARG _pdbx_validate_chiral.auth_seq_id 16 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details PLANAR _pdbx_validate_chiral.omega . #