data_1AVZ # _entry.id 1AVZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1AVZ pdb_00001avz 10.2210/pdb1avz/pdb WWPDB D_1000171324 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1AVZ _pdbx_database_status.recvd_initial_deposition_date 1997-09-23 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Arold, S.' 1 'Franken, P.' 2 'Dumas, C.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;The crystal structure of HIV-1 Nef protein bound to the Fyn kinase SH3 domain suggests a role for this complex in altered T cell receptor signaling. ; Structure 5 1361 1372 1997 STRUE6 UK 0969-2126 2005 ? 9351809 '10.1016/S0969-2126(97)00286-4' 1 'Crystal Structure of the Conserved Core of HIV-1 Nef Complexed with a Src Family SH3 Domain' 'Cell(Cambridge,Mass.)' 85 931 ? 1996 CELLB5 US 0092-8674 0998 ? ? ? 2 ;The Solution Structure of HIV-1 Nef Reveals an Unexpected Fold and Permits Delineation of the Binding Surface for the SH3 Domain of HCK Tyrosine Protein Kinase ; Nat.Struct.Biol. 3 340 ? 1996 NSBIEW US 1072-8368 2024 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Arold, S.' 1 ? primary 'Franken, P.' 2 ? primary 'Strub, M.P.' 3 ? primary 'Hoh, F.' 4 ? primary 'Benichou, S.' 5 ? primary 'Benarous, R.' 6 ? primary 'Dumas, C.' 7 ? 1 'Lee, C.H.' 8 ? 1 'Saksela, K.' 9 ? 1 'Mirza, U.A.' 10 ? 1 'Chait, B.T.' 11 ? 1 'Kuriyan, J.' 12 ? 2 'Grzesiek, S.' 13 ? 2 'Bax, A.' 14 ? 2 'Clore, G.M.' 15 ? 2 'Gronenborn, A.M.' 16 ? 2 'Hu, J.S.' 17 ? 2 'Kaufman, J.' 18 ? 2 'Palmer, I.' 19 ? 2 'Stahl, S.J.' 20 ? 2 'Wingfield, P.T.' 21 ? # _cell.entry_id 1AVZ _cell.length_a 108.200 _cell.length_b 108.200 _cell.length_c 223.700 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1AVZ _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'NEGATIVE FACTOR' 17568.723 2 ? 'N-TERMINAL RESIDUES GS (PART OF A THROMBIN CLEAVAGE SITE)' 'CONSERVED CORE DOMAIN' ? 2 polymer man 'FYN TYROSINE KINASE' 6524.066 1 2.7.1.112 ? 'SRC-HOMOLOGY 3 DOMAIN' ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'NEF, F-PROTEIN' 2 'SH3 DOMAIN' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSLEAQEEEEVGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGYFPDWQNYTPGPGVRY PLTFGWCYKLVPVEPDKVEEANKGENTSLLHPVSLHGMDDPEREVLEWRFDSRLAFHHVARELHPEYFKNC ; ;GSLEAQEEEEVGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGYFPDWQNYTPGPGVRY PLTFGWCYKLVPVEPDKVEEANKGENTSLLHPVSLHGMDDPEREVLEWRFDSRLAFHHVARELHPEYFKNC ; A,B ? 2 'polypeptide(L)' no no TLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPV TLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPV C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 LEU n 1 4 GLU n 1 5 ALA n 1 6 GLN n 1 7 GLU n 1 8 GLU n 1 9 GLU n 1 10 GLU n 1 11 VAL n 1 12 GLY n 1 13 PHE n 1 14 PRO n 1 15 VAL n 1 16 THR n 1 17 PRO n 1 18 GLN n 1 19 VAL n 1 20 PRO n 1 21 LEU n 1 22 ARG n 1 23 PRO n 1 24 MET n 1 25 THR n 1 26 TYR n 1 27 LYS n 1 28 ALA n 1 29 ALA n 1 30 VAL n 1 31 ASP n 1 32 LEU n 1 33 SER n 1 34 HIS n 1 35 PHE n 1 36 LEU n 1 37 LYS n 1 38 GLU n 1 39 LYS n 1 40 GLY n 1 41 GLY n 1 42 LEU n 1 43 GLU n 1 44 GLY n 1 45 LEU n 1 46 ILE n 1 47 HIS n 1 48 SER n 1 49 GLN n 1 50 ARG n 1 51 ARG n 1 52 GLN n 1 53 ASP n 1 54 ILE n 1 55 LEU n 1 56 ASP n 1 57 LEU n 1 58 TRP n 1 59 ILE n 1 60 TYR n 1 61 HIS n 1 62 THR n 1 63 GLN n 1 64 GLY n 1 65 TYR n 1 66 PHE n 1 67 PRO n 1 68 ASP n 1 69 TRP n 1 70 GLN n 1 71 ASN n 1 72 TYR n 1 73 THR n 1 74 PRO n 1 75 GLY n 1 76 PRO n 1 77 GLY n 1 78 VAL n 1 79 ARG n 1 80 TYR n 1 81 PRO n 1 82 LEU n 1 83 THR n 1 84 PHE n 1 85 GLY n 1 86 TRP n 1 87 CYS n 1 88 TYR n 1 89 LYS n 1 90 LEU n 1 91 VAL n 1 92 PRO n 1 93 VAL n 1 94 GLU n 1 95 PRO n 1 96 ASP n 1 97 LYS n 1 98 VAL n 1 99 GLU n 1 100 GLU n 1 101 ALA n 1 102 ASN n 1 103 LYS n 1 104 GLY n 1 105 GLU n 1 106 ASN n 1 107 THR n 1 108 SER n 1 109 LEU n 1 110 LEU n 1 111 HIS n 1 112 PRO n 1 113 VAL n 1 114 SER n 1 115 LEU n 1 116 HIS n 1 117 GLY n 1 118 MET n 1 119 ASP n 1 120 ASP n 1 121 PRO n 1 122 GLU n 1 123 ARG n 1 124 GLU n 1 125 VAL n 1 126 LEU n 1 127 GLU n 1 128 TRP n 1 129 ARG n 1 130 PHE n 1 131 ASP n 1 132 SER n 1 133 ARG n 1 134 LEU n 1 135 ALA n 1 136 PHE n 1 137 HIS n 1 138 HIS n 1 139 VAL n 1 140 ALA n 1 141 ARG n 1 142 GLU n 1 143 LEU n 1 144 HIS n 1 145 PRO n 1 146 GLU n 1 147 TYR n 1 148 PHE n 1 149 LYS n 1 150 ASN n 1 151 CYS n 2 1 THR n 2 2 LEU n 2 3 PHE n 2 4 VAL n 2 5 ALA n 2 6 LEU n 2 7 TYR n 2 8 ASP n 2 9 TYR n 2 10 GLU n 2 11 ALA n 2 12 ARG n 2 13 THR n 2 14 GLU n 2 15 ASP n 2 16 ASP n 2 17 LEU n 2 18 SER n 2 19 PHE n 2 20 HIS n 2 21 LYS n 2 22 GLY n 2 23 GLU n 2 24 LYS n 2 25 PHE n 2 26 GLN n 2 27 ILE n 2 28 LEU n 2 29 ASN n 2 30 SER n 2 31 SER n 2 32 GLU n 2 33 GLY n 2 34 ASP n 2 35 TRP n 2 36 TRP n 2 37 GLU n 2 38 ALA n 2 39 ARG n 2 40 SER n 2 41 LEU n 2 42 THR n 2 43 THR n 2 44 GLY n 2 45 GLU n 2 46 THR n 2 47 GLY n 2 48 TYR n 2 49 ILE n 2 50 PRO n 2 51 SER n 2 52 ASN n 2 53 TYR n 2 54 VAL n 2 55 ALA n 2 56 PRO n 2 57 VAL n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? ? Lentivirus 'HIV-1 NEF' ? ? ? ? ? ? 'Human immunodeficiency virus 1' 11676 'LAI ISOLATE' BL21 ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21 (DE3)' ? ? ? ? ? ? ? ? ? ? ? PGEX-2T ? ? 2 1 sample ? ? ? human Homo 'FYN TYROSINE KINASE' ? ? ? ? ? ? 'Homo sapiens' 9606 ? BL21 ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia ? ? 'Escherichia coli' ? ? 'BL21 (DE3)' ? ? ? ? ? ? ? ? ? ? ? PGEX-2T ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_db_accession _struct_ref.pdbx_align_begin _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_db_isoform 1 UNP NEF_HV1BR 1 P03406 1 ;MGGKWSKSSVVGWPTVRERMRRAEPAADGVGAASRDLEKHGAITSSNTAATNAACAWLEAQEEEEVGFPVTPQVPLRPMT YKAAVDLSHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGYFPDWQNYTPGPGVRYPLTFGWCYKLVPVEPDKVEEANKGE NTSLLHPVSLHGMDDPEREVLEWRFDSRLAFHHVARELHPEYFKNC ; ? 2 UNP FYN_HUMAN 2 P06241 1 ;GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGG TGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAER QLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCR LVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKL KHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNG LICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVER GYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL ; ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1AVZ A 3 ? 151 ? P03406 58 ? 206 ? 58 206 2 1 1AVZ B 3 ? 151 ? P03406 58 ? 206 ? 58 206 3 2 1AVZ C 1 ? 57 ? P06241 84 ? 140 ? 85 141 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1AVZ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 4.2 _exptl_crystal.density_percent_sol 70. _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.9 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 8.9' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'PRINCETON 2K' _diffrn_detector.pdbx_collection_date 1996-10-04 _diffrn_detector.details 'TWO BENT MIRRORS' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI(111)' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0373 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE BM02' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline BM02 _diffrn_source.pdbx_wavelength 1.0373 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1AVZ _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 25.0 _reflns.d_resolution_high 3.0 _reflns.number_obs 14778 _reflns.number_all ? _reflns.percent_possible_obs 91. _reflns.pdbx_Rmerge_I_obs 0.0670000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 4.1 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.entry_id 1AVZ _refine.ls_number_reflns_obs 11662 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF 10000000.00 _refine.pdbx_data_cutoff_low_absF 0.001 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30. _refine.ls_d_res_high 3.0 _refine.ls_percent_reflns_obs 75.6 _refine.ls_R_factor_obs 0.2200000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2200000 _refine.ls_R_factor_R_free 0.2700000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.0 _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 33.0 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'PDB ENTRIES 1EFN AND 1SHF' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2216 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2216 _refine_hist.d_res_high 3.0 _refine_hist.d_res_low 30. # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.010 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.4 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 24.1 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.21 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1AVZ _struct.title 'V-1 NEF PROTEIN IN COMPLEX WITH WILD TYPE FYN SH3 DOMAIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1AVZ _struct_keywords.pdbx_keywords 'COMPLEX (MYRISTYLATION/TRANSFERASE)' _struct_keywords.text ;COMPLEX (MYRISTYLATION-TRANSFERASE), GTP-BINDING, HIV-1, PHOSPHORYLATION, NEF, SH3 DOMAIN, FYN, TYROSINE KINASE, COMPLEX (MYRISTYLATION-TRANSFERASE) complex ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 26 ? LYS A 39 ? TYR A 81 LYS A 94 1 ? 14 HELX_P HELX_P2 2 GLN A 49 ? THR A 62 ? GLN A 104 THR A 117 1 ? 14 HELX_P HELX_P3 3 SER A 132 ? ALA A 135 ? SER A 187 ALA A 190 5 ? 4 HELX_P HELX_P4 4 VAL A 139 ? GLU A 142 ? VAL A 194 GLU A 197 1 ? 4 HELX_P HELX_P5 5 TYR B 26 ? LYS B 39 ? TYR B 81 LYS B 94 1 ? 14 HELX_P HELX_P6 6 GLN B 49 ? THR B 62 ? GLN B 104 THR B 117 1 ? 14 HELX_P HELX_P7 7 SER B 132 ? ALA B 135 ? SER B 187 ALA B 190 5 ? 4 HELX_P HELX_P8 8 VAL B 139 ? GLU B 142 ? VAL B 194 GLU B 197 1 ? 4 HELX_P HELX_P9 9 SER C 51 ? TYR C 53 ? SER C 135 TYR C 137 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 75 A . ? GLY 130 A PRO 76 A ? PRO 131 A 1 0.11 2 GLY 75 B . ? GLY 130 B PRO 76 B ? PRO 131 B 1 -0.35 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 88 ? PRO A 92 ? TYR A 143 PRO A 147 A 2 LEU A 126 ? PHE A 130 ? LEU A 181 PHE A 185 B 1 TYR B 88 ? PRO B 92 ? TYR B 143 PRO B 147 B 2 LEU B 126 ? PHE B 130 ? LEU B 181 PHE B 185 C 1 TRP C 35 ? ARG C 39 ? TRP C 119 ARG C 123 C 2 THR C 46 ? PRO C 50 ? THR C 130 PRO C 134 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 89 ? O LYS A 144 N ARG A 129 ? N ARG A 184 B 1 2 O LYS B 89 ? O LYS B 144 N ARG B 129 ? N ARG B 184 C 1 2 O TRP C 36 ? O TRP C 120 N ILE C 49 ? N ILE C 133 # _database_PDB_matrix.entry_id 1AVZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1AVZ _atom_sites.fract_transf_matrix[1][1] 0.009242 _atom_sites.fract_transf_matrix[1][2] 0.005336 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010672 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004470 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 56 ? ? ? A . n A 1 2 SER 2 57 ? ? ? A . n A 1 3 LEU 3 58 ? ? ? A . n A 1 4 GLU 4 59 ? ? ? A . n A 1 5 ALA 5 60 ? ? ? A . n A 1 6 GLN 6 61 ? ? ? A . n A 1 7 GLU 7 62 ? ? ? A . n A 1 8 GLU 8 63 ? ? ? A . n A 1 9 GLU 9 64 ? ? ? A . n A 1 10 GLU 10 65 ? ? ? A . n A 1 11 VAL 11 66 ? ? ? A . n A 1 12 GLY 12 67 ? ? ? A . n A 1 13 PHE 13 68 ? ? ? A . n A 1 14 PRO 14 69 ? ? ? A . n A 1 15 VAL 15 70 ? ? ? A . n A 1 16 THR 16 71 ? ? ? A . n A 1 17 PRO 17 72 ? ? ? A . n A 1 18 GLN 18 73 ? ? ? A . n A 1 19 VAL 19 74 74 VAL VAL A . n A 1 20 PRO 20 75 75 PRO PRO A . n A 1 21 LEU 21 76 76 LEU LEU A . n A 1 22 ARG 22 77 77 ARG ARG A . n A 1 23 PRO 23 78 78 PRO PRO A . n A 1 24 MET 24 79 79 MET MET A . n A 1 25 THR 25 80 80 THR THR A . n A 1 26 TYR 26 81 81 TYR TYR A . n A 1 27 LYS 27 82 82 LYS LYS A . n A 1 28 ALA 28 83 83 ALA ALA A . n A 1 29 ALA 29 84 84 ALA ALA A . n A 1 30 VAL 30 85 85 VAL VAL A . n A 1 31 ASP 31 86 86 ASP ASP A . n A 1 32 LEU 32 87 87 LEU LEU A . n A 1 33 SER 33 88 88 SER SER A . n A 1 34 HIS 34 89 89 HIS HIS A . n A 1 35 PHE 35 90 90 PHE PHE A . n A 1 36 LEU 36 91 91 LEU LEU A . n A 1 37 LYS 37 92 92 LYS LYS A . n A 1 38 GLU 38 93 93 GLU GLU A . n A 1 39 LYS 39 94 94 LYS LYS A . n A 1 40 GLY 40 95 95 GLY GLY A . n A 1 41 GLY 41 96 96 GLY GLY A . n A 1 42 LEU 42 97 97 LEU LEU A . n A 1 43 GLU 43 98 98 GLU GLU A . n A 1 44 GLY 44 99 99 GLY GLY A . n A 1 45 LEU 45 100 100 LEU LEU A . n A 1 46 ILE 46 101 101 ILE ILE A . n A 1 47 HIS 47 102 102 HIS HIS A . n A 1 48 SER 48 103 103 SER SER A . n A 1 49 GLN 49 104 104 GLN GLN A . n A 1 50 ARG 50 105 105 ARG ARG A . n A 1 51 ARG 51 106 106 ARG ARG A . n A 1 52 GLN 52 107 107 GLN GLN A . n A 1 53 ASP 53 108 108 ASP ASP A . n A 1 54 ILE 54 109 109 ILE ILE A . n A 1 55 LEU 55 110 110 LEU LEU A . n A 1 56 ASP 56 111 111 ASP ASP A . n A 1 57 LEU 57 112 112 LEU LEU A . n A 1 58 TRP 58 113 113 TRP TRP A . n A 1 59 ILE 59 114 114 ILE ILE A . n A 1 60 TYR 60 115 115 TYR TYR A . n A 1 61 HIS 61 116 116 HIS HIS A . n A 1 62 THR 62 117 117 THR THR A . n A 1 63 GLN 63 118 118 GLN GLN A . n A 1 64 GLY 64 119 119 GLY GLY A . n A 1 65 TYR 65 120 120 TYR TYR A . n A 1 66 PHE 66 121 121 PHE PHE A . n A 1 67 PRO 67 122 122 PRO PRO A . n A 1 68 ASP 68 123 123 ASP ASP A . n A 1 69 TRP 69 124 124 TRP TRP A . n A 1 70 GLN 70 125 125 GLN GLN A . n A 1 71 ASN 71 126 126 ASN ASN A . n A 1 72 TYR 72 127 127 TYR TYR A . n A 1 73 THR 73 128 128 THR THR A . n A 1 74 PRO 74 129 129 PRO PRO A . n A 1 75 GLY 75 130 130 GLY GLY A . n A 1 76 PRO 76 131 131 PRO PRO A . n A 1 77 GLY 77 132 132 GLY GLY A . n A 1 78 VAL 78 133 133 VAL VAL A . n A 1 79 ARG 79 134 134 ARG ARG A . n A 1 80 TYR 80 135 135 TYR TYR A . n A 1 81 PRO 81 136 136 PRO PRO A . n A 1 82 LEU 82 137 137 LEU LEU A . n A 1 83 THR 83 138 138 THR THR A . n A 1 84 PHE 84 139 139 PHE PHE A . n A 1 85 GLY 85 140 140 GLY GLY A . n A 1 86 TRP 86 141 141 TRP TRP A . n A 1 87 CYS 87 142 142 CYS CYS A . n A 1 88 TYR 88 143 143 TYR TYR A . n A 1 89 LYS 89 144 144 LYS LYS A . n A 1 90 LEU 90 145 145 LEU LEU A . n A 1 91 VAL 91 146 146 VAL VAL A . n A 1 92 PRO 92 147 147 PRO PRO A . n A 1 93 VAL 93 148 148 VAL VAL A . n A 1 94 GLU 94 149 ? ? ? A . n A 1 95 PRO 95 150 ? ? ? A . n A 1 96 ASP 96 151 ? ? ? A . n A 1 97 LYS 97 152 ? ? ? A . n A 1 98 VAL 98 153 ? ? ? A . n A 1 99 GLU 99 154 ? ? ? A . n A 1 100 GLU 100 155 ? ? ? A . n A 1 101 ALA 101 156 ? ? ? A . n A 1 102 ASN 102 157 ? ? ? A . n A 1 103 LYS 103 158 ? ? ? A . n A 1 104 GLY 104 159 ? ? ? A . n A 1 105 GLU 105 160 ? ? ? A . n A 1 106 ASN 106 161 ? ? ? A . n A 1 107 THR 107 162 ? ? ? A . n A 1 108 SER 108 163 ? ? ? A . n A 1 109 LEU 109 164 ? ? ? A . n A 1 110 LEU 110 165 ? ? ? A . n A 1 111 HIS 111 166 ? ? ? A . n A 1 112 PRO 112 167 ? ? ? A . n A 1 113 VAL 113 168 ? ? ? A . n A 1 114 SER 114 169 ? ? ? A . n A 1 115 LEU 115 170 ? ? ? A . n A 1 116 HIS 116 171 ? ? ? A . n A 1 117 GLY 117 172 ? ? ? A . n A 1 118 MET 118 173 ? ? ? A . n A 1 119 ASP 119 174 ? ? ? A . n A 1 120 ASP 120 175 ? ? ? A . n A 1 121 PRO 121 176 ? ? ? A . n A 1 122 GLU 122 177 ? ? ? A . n A 1 123 ARG 123 178 ? ? ? A . n A 1 124 GLU 124 179 179 GLU GLU A . n A 1 125 VAL 125 180 180 VAL VAL A . n A 1 126 LEU 126 181 181 LEU LEU A . n A 1 127 GLU 127 182 182 GLU GLU A . n A 1 128 TRP 128 183 183 TRP TRP A . n A 1 129 ARG 129 184 184 ARG ARG A . n A 1 130 PHE 130 185 185 PHE PHE A . n A 1 131 ASP 131 186 186 ASP ASP A . n A 1 132 SER 132 187 187 SER SER A . n A 1 133 ARG 133 188 188 ARG ARG A . n A 1 134 LEU 134 189 189 LEU LEU A . n A 1 135 ALA 135 190 190 ALA ALA A . n A 1 136 PHE 136 191 191 PHE PHE A . n A 1 137 HIS 137 192 192 HIS HIS A . n A 1 138 HIS 138 193 193 HIS HIS A . n A 1 139 VAL 139 194 194 VAL VAL A . n A 1 140 ALA 140 195 195 ALA ALA A . n A 1 141 ARG 141 196 196 ARG ARG A . n A 1 142 GLU 142 197 197 GLU GLU A . n A 1 143 LEU 143 198 198 LEU LEU A . n A 1 144 HIS 144 199 199 HIS HIS A . n A 1 145 PRO 145 200 200 PRO PRO A . n A 1 146 GLU 146 201 201 GLU GLU A . n A 1 147 TYR 147 202 202 TYR TYR A . n A 1 148 PHE 148 203 203 PHE PHE A . n A 1 149 LYS 149 204 ? ? ? A . n A 1 150 ASN 150 205 ? ? ? A . n A 1 151 CYS 151 206 ? ? ? A . n B 1 1 GLY 1 56 ? ? ? B . n B 1 2 SER 2 57 ? ? ? B . n B 1 3 LEU 3 58 ? ? ? B . n B 1 4 GLU 4 59 ? ? ? B . n B 1 5 ALA 5 60 ? ? ? B . n B 1 6 GLN 6 61 ? ? ? B . n B 1 7 GLU 7 62 ? ? ? B . n B 1 8 GLU 8 63 ? ? ? B . n B 1 9 GLU 9 64 ? ? ? B . n B 1 10 GLU 10 65 ? ? ? B . n B 1 11 VAL 11 66 ? ? ? B . n B 1 12 GLY 12 67 ? ? ? B . n B 1 13 PHE 13 68 ? ? ? B . n B 1 14 PRO 14 69 ? ? ? B . n B 1 15 VAL 15 70 ? ? ? B . n B 1 16 THR 16 71 71 THR THR B . n B 1 17 PRO 17 72 72 PRO PRO B . n B 1 18 GLN 18 73 73 GLN GLN B . n B 1 19 VAL 19 74 74 VAL VAL B . n B 1 20 PRO 20 75 75 PRO PRO B . n B 1 21 LEU 21 76 76 LEU LEU B . n B 1 22 ARG 22 77 77 ARG ARG B . n B 1 23 PRO 23 78 78 PRO PRO B . n B 1 24 MET 24 79 79 MET MET B . n B 1 25 THR 25 80 80 THR THR B . n B 1 26 TYR 26 81 81 TYR TYR B . n B 1 27 LYS 27 82 82 LYS LYS B . n B 1 28 ALA 28 83 83 ALA ALA B . n B 1 29 ALA 29 84 84 ALA ALA B . n B 1 30 VAL 30 85 85 VAL VAL B . n B 1 31 ASP 31 86 86 ASP ASP B . n B 1 32 LEU 32 87 87 LEU LEU B . n B 1 33 SER 33 88 88 SER SER B . n B 1 34 HIS 34 89 89 HIS HIS B . n B 1 35 PHE 35 90 90 PHE PHE B . n B 1 36 LEU 36 91 91 LEU LEU B . n B 1 37 LYS 37 92 92 LYS LYS B . n B 1 38 GLU 38 93 93 GLU GLU B . n B 1 39 LYS 39 94 94 LYS LYS B . n B 1 40 GLY 40 95 95 GLY GLY B . n B 1 41 GLY 41 96 96 GLY GLY B . n B 1 42 LEU 42 97 97 LEU LEU B . n B 1 43 GLU 43 98 98 GLU GLU B . n B 1 44 GLY 44 99 99 GLY GLY B . n B 1 45 LEU 45 100 100 LEU LEU B . n B 1 46 ILE 46 101 101 ILE ILE B . n B 1 47 HIS 47 102 102 HIS HIS B . n B 1 48 SER 48 103 103 SER SER B . n B 1 49 GLN 49 104 104 GLN GLN B . n B 1 50 ARG 50 105 105 ARG ARG B . n B 1 51 ARG 51 106 106 ARG ARG B . n B 1 52 GLN 52 107 107 GLN GLN B . n B 1 53 ASP 53 108 108 ASP ASP B . n B 1 54 ILE 54 109 109 ILE ILE B . n B 1 55 LEU 55 110 110 LEU LEU B . n B 1 56 ASP 56 111 111 ASP ASP B . n B 1 57 LEU 57 112 112 LEU LEU B . n B 1 58 TRP 58 113 113 TRP TRP B . n B 1 59 ILE 59 114 114 ILE ILE B . n B 1 60 TYR 60 115 115 TYR TYR B . n B 1 61 HIS 61 116 116 HIS HIS B . n B 1 62 THR 62 117 117 THR THR B . n B 1 63 GLN 63 118 118 GLN GLN B . n B 1 64 GLY 64 119 119 GLY GLY B . n B 1 65 TYR 65 120 120 TYR TYR B . n B 1 66 PHE 66 121 121 PHE PHE B . n B 1 67 PRO 67 122 122 PRO PRO B . n B 1 68 ASP 68 123 123 ASP ASP B . n B 1 69 TRP 69 124 124 TRP TRP B . n B 1 70 GLN 70 125 125 GLN GLN B . n B 1 71 ASN 71 126 126 ASN ASN B . n B 1 72 TYR 72 127 127 TYR TYR B . n B 1 73 THR 73 128 128 THR THR B . n B 1 74 PRO 74 129 129 PRO PRO B . n B 1 75 GLY 75 130 130 GLY GLY B . n B 1 76 PRO 76 131 131 PRO PRO B . n B 1 77 GLY 77 132 132 GLY GLY B . n B 1 78 VAL 78 133 133 VAL VAL B . n B 1 79 ARG 79 134 134 ARG ARG B . n B 1 80 TYR 80 135 135 TYR TYR B . n B 1 81 PRO 81 136 136 PRO PRO B . n B 1 82 LEU 82 137 137 LEU LEU B . n B 1 83 THR 83 138 138 THR THR B . n B 1 84 PHE 84 139 139 PHE PHE B . n B 1 85 GLY 85 140 140 GLY GLY B . n B 1 86 TRP 86 141 141 TRP TRP B . n B 1 87 CYS 87 142 142 CYS CYS B . n B 1 88 TYR 88 143 143 TYR TYR B . n B 1 89 LYS 89 144 144 LYS LYS B . n B 1 90 LEU 90 145 145 LEU LEU B . n B 1 91 VAL 91 146 146 VAL VAL B . n B 1 92 PRO 92 147 147 PRO PRO B . n B 1 93 VAL 93 148 148 VAL VAL B . n B 1 94 GLU 94 149 ? ? ? B . n B 1 95 PRO 95 150 ? ? ? B . n B 1 96 ASP 96 151 ? ? ? B . n B 1 97 LYS 97 152 ? ? ? B . n B 1 98 VAL 98 153 ? ? ? B . n B 1 99 GLU 99 154 ? ? ? B . n B 1 100 GLU 100 155 ? ? ? B . n B 1 101 ALA 101 156 ? ? ? B . n B 1 102 ASN 102 157 ? ? ? B . n B 1 103 LYS 103 158 ? ? ? B . n B 1 104 GLY 104 159 ? ? ? B . n B 1 105 GLU 105 160 ? ? ? B . n B 1 106 ASN 106 161 ? ? ? B . n B 1 107 THR 107 162 ? ? ? B . n B 1 108 SER 108 163 ? ? ? B . n B 1 109 LEU 109 164 ? ? ? B . n B 1 110 LEU 110 165 ? ? ? B . n B 1 111 HIS 111 166 ? ? ? B . n B 1 112 PRO 112 167 ? ? ? B . n B 1 113 VAL 113 168 ? ? ? B . n B 1 114 SER 114 169 ? ? ? B . n B 1 115 LEU 115 170 ? ? ? B . n B 1 116 HIS 116 171 ? ? ? B . n B 1 117 GLY 117 172 ? ? ? B . n B 1 118 MET 118 173 ? ? ? B . n B 1 119 ASP 119 174 ? ? ? B . n B 1 120 ASP 120 175 ? ? ? B . n B 1 121 PRO 121 176 ? ? ? B . n B 1 122 GLU 122 177 ? ? ? B . n B 1 123 ARG 123 178 ? ? ? B . n B 1 124 GLU 124 179 179 GLU GLU B . n B 1 125 VAL 125 180 180 VAL VAL B . n B 1 126 LEU 126 181 181 LEU LEU B . n B 1 127 GLU 127 182 182 GLU GLU B . n B 1 128 TRP 128 183 183 TRP TRP B . n B 1 129 ARG 129 184 184 ARG ARG B . n B 1 130 PHE 130 185 185 PHE PHE B . n B 1 131 ASP 131 186 186 ASP ASP B . n B 1 132 SER 132 187 187 SER SER B . n B 1 133 ARG 133 188 188 ARG ARG B . n B 1 134 LEU 134 189 189 LEU LEU B . n B 1 135 ALA 135 190 190 ALA ALA B . n B 1 136 PHE 136 191 191 PHE PHE B . n B 1 137 HIS 137 192 192 HIS HIS B . n B 1 138 HIS 138 193 193 HIS HIS B . n B 1 139 VAL 139 194 194 VAL VAL B . n B 1 140 ALA 140 195 195 ALA ALA B . n B 1 141 ARG 141 196 196 ARG ARG B . n B 1 142 GLU 142 197 197 GLU GLU B . n B 1 143 LEU 143 198 198 LEU LEU B . n B 1 144 HIS 144 199 199 HIS HIS B . n B 1 145 PRO 145 200 200 PRO PRO B . n B 1 146 GLU 146 201 201 GLU GLU B . n B 1 147 TYR 147 202 202 TYR TYR B . n B 1 148 PHE 148 203 203 PHE PHE B . n B 1 149 LYS 149 204 ? ? ? B . n B 1 150 ASN 150 205 ? ? ? B . n B 1 151 CYS 151 206 ? ? ? B . n C 2 1 THR 1 85 85 THR THR C . n C 2 2 LEU 2 86 86 LEU LEU C . n C 2 3 PHE 3 87 87 PHE PHE C . n C 2 4 VAL 4 88 88 VAL VAL C . n C 2 5 ALA 5 89 89 ALA ALA C . n C 2 6 LEU 6 90 90 LEU LEU C . n C 2 7 TYR 7 91 91 TYR TYR C . n C 2 8 ASP 8 92 92 ASP ASP C . n C 2 9 TYR 9 93 93 TYR TYR C . n C 2 10 GLU 10 94 94 GLU GLU C . n C 2 11 ALA 11 95 95 ALA ALA C . n C 2 12 ARG 12 96 96 ARG ARG C . n C 2 13 THR 13 97 97 THR THR C . n C 2 14 GLU 14 98 98 GLU GLU C . n C 2 15 ASP 15 99 99 ASP ASP C . n C 2 16 ASP 16 100 100 ASP ASP C . n C 2 17 LEU 17 101 101 LEU LEU C . n C 2 18 SER 18 102 102 SER SER C . n C 2 19 PHE 19 103 103 PHE PHE C . n C 2 20 HIS 20 104 104 HIS HIS C . n C 2 21 LYS 21 105 105 LYS LYS C . n C 2 22 GLY 22 106 106 GLY GLY C . n C 2 23 GLU 23 107 107 GLU GLU C . n C 2 24 LYS 24 108 108 LYS LYS C . n C 2 25 PHE 25 109 109 PHE PHE C . n C 2 26 GLN 26 110 110 GLN GLN C . n C 2 27 ILE 27 111 111 ILE ILE C . n C 2 28 LEU 28 112 112 LEU LEU C . n C 2 29 ASN 29 113 113 ASN ASN C . n C 2 30 SER 30 114 114 SER SER C . n C 2 31 SER 31 115 115 SER SER C . n C 2 32 GLU 32 116 116 GLU GLU C . n C 2 33 GLY 33 117 117 GLY GLY C . n C 2 34 ASP 34 118 118 ASP ASP C . n C 2 35 TRP 35 119 119 TRP TRP C . n C 2 36 TRP 36 120 120 TRP TRP C . n C 2 37 GLU 37 121 121 GLU GLU C . n C 2 38 ALA 38 122 122 ALA ALA C . n C 2 39 ARG 39 123 123 ARG ARG C . n C 2 40 SER 40 124 124 SER SER C . n C 2 41 LEU 41 125 125 LEU LEU C . n C 2 42 THR 42 126 126 THR THR C . n C 2 43 THR 43 127 127 THR THR C . n C 2 44 GLY 44 128 128 GLY GLY C . n C 2 45 GLU 45 129 129 GLU GLU C . n C 2 46 THR 46 130 130 THR THR C . n C 2 47 GLY 47 131 131 GLY GLY C . n C 2 48 TYR 48 132 132 TYR TYR C . n C 2 49 ILE 49 133 133 ILE ILE C . n C 2 50 PRO 50 134 134 PRO PRO C . n C 2 51 SER 51 135 135 SER SER C . n C 2 52 ASN 52 136 136 ASN ASN C . n C 2 53 TYR 53 137 137 TYR TYR C . n C 2 54 VAL 54 138 138 VAL VAL C . n C 2 55 ALA 55 139 139 ALA ALA C . n C 2 56 PRO 56 140 140 PRO PRO C . n C 2 57 VAL 57 141 141 VAL VAL C . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-03-25 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-04-04 5 'Structure model' 1 4 2018-04-11 6 'Structure model' 1 5 2023-08-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' Other 5 5 'Structure model' 'Data collection' 6 6 'Structure model' 'Database references' 7 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' diffrn_source 2 4 'Structure model' pdbx_database_status 3 5 'Structure model' diffrn_source 4 6 'Structure model' database_2 5 6 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_diffrn_source.type' 2 4 'Structure model' '_pdbx_database_status.process_site' 3 5 'Structure model' '_diffrn_source.pdbx_synchrotron_beamline' 4 6 'Structure model' '_database_2.pdbx_DOI' 5 6 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.8 ? 1 X-PLOR refinement 3.8 ? 2 XDS 'data reduction' . ? 3 XSCALE 'data scaling' . ? 4 X-PLOR phasing 3.8 ? 5 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 PHE _pdbx_validate_rmsd_angle.auth_seq_id_1 121 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 122 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CA _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 122 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 130.95 _pdbx_validate_rmsd_angle.angle_target_value 119.30 _pdbx_validate_rmsd_angle.angle_deviation 11.65 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.50 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 79 ? ? -68.12 97.24 2 1 PRO A 122 ? ? -54.06 44.29 3 1 CYS A 142 ? ? -87.92 36.00 4 1 ALA A 195 ? ? -68.93 10.08 5 1 ARG A 196 ? ? -132.38 -30.99 6 1 HIS A 199 ? ? -117.88 68.55 7 1 TYR A 202 ? ? -63.12 0.82 8 1 PRO B 75 ? ? -49.28 162.08 9 1 LEU B 110 ? ? -61.53 -73.62 10 1 PRO B 122 ? ? -60.22 51.69 11 1 CYS B 142 ? ? -76.01 25.50 12 1 LEU B 198 ? ? -91.00 -70.49 13 1 TYR B 202 ? ? -55.49 -0.77 14 1 LYS C 105 ? ? -30.50 102.46 15 1 GLN C 110 ? ? -169.51 112.76 16 1 ASN C 113 ? ? -161.26 94.47 17 1 SER C 115 ? ? -67.73 67.56 18 1 GLU C 116 ? ? -170.69 -3.33 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 56 ? A GLY 1 2 1 Y 1 A SER 57 ? A SER 2 3 1 Y 1 A LEU 58 ? A LEU 3 4 1 Y 1 A GLU 59 ? A GLU 4 5 1 Y 1 A ALA 60 ? A ALA 5 6 1 Y 1 A GLN 61 ? A GLN 6 7 1 Y 1 A GLU 62 ? A GLU 7 8 1 Y 1 A GLU 63 ? A GLU 8 9 1 Y 1 A GLU 64 ? A GLU 9 10 1 Y 1 A GLU 65 ? A GLU 10 11 1 Y 1 A VAL 66 ? A VAL 11 12 1 Y 1 A GLY 67 ? A GLY 12 13 1 Y 1 A PHE 68 ? A PHE 13 14 1 Y 1 A PRO 69 ? A PRO 14 15 1 Y 1 A VAL 70 ? A VAL 15 16 1 Y 1 A THR 71 ? A THR 16 17 1 Y 1 A PRO 72 ? A PRO 17 18 1 Y 1 A GLN 73 ? A GLN 18 19 1 Y 1 A GLU 149 ? A GLU 94 20 1 Y 1 A PRO 150 ? A PRO 95 21 1 Y 1 A ASP 151 ? A ASP 96 22 1 Y 1 A LYS 152 ? A LYS 97 23 1 Y 1 A VAL 153 ? A VAL 98 24 1 Y 1 A GLU 154 ? A GLU 99 25 1 Y 1 A GLU 155 ? A GLU 100 26 1 Y 1 A ALA 156 ? A ALA 101 27 1 Y 1 A ASN 157 ? A ASN 102 28 1 Y 1 A LYS 158 ? A LYS 103 29 1 Y 1 A GLY 159 ? A GLY 104 30 1 Y 1 A GLU 160 ? A GLU 105 31 1 Y 1 A ASN 161 ? A ASN 106 32 1 Y 1 A THR 162 ? A THR 107 33 1 Y 1 A SER 163 ? A SER 108 34 1 Y 1 A LEU 164 ? A LEU 109 35 1 Y 1 A LEU 165 ? A LEU 110 36 1 Y 1 A HIS 166 ? A HIS 111 37 1 Y 1 A PRO 167 ? A PRO 112 38 1 Y 1 A VAL 168 ? A VAL 113 39 1 Y 1 A SER 169 ? A SER 114 40 1 Y 1 A LEU 170 ? A LEU 115 41 1 Y 1 A HIS 171 ? A HIS 116 42 1 Y 1 A GLY 172 ? A GLY 117 43 1 Y 1 A MET 173 ? A MET 118 44 1 Y 1 A ASP 174 ? A ASP 119 45 1 Y 1 A ASP 175 ? A ASP 120 46 1 Y 1 A PRO 176 ? A PRO 121 47 1 Y 1 A GLU 177 ? A GLU 122 48 1 Y 1 A ARG 178 ? A ARG 123 49 1 Y 1 A LYS 204 ? A LYS 149 50 1 Y 1 A ASN 205 ? A ASN 150 51 1 Y 1 A CYS 206 ? A CYS 151 52 1 Y 1 B GLY 56 ? B GLY 1 53 1 Y 1 B SER 57 ? B SER 2 54 1 Y 1 B LEU 58 ? B LEU 3 55 1 Y 1 B GLU 59 ? B GLU 4 56 1 Y 1 B ALA 60 ? B ALA 5 57 1 Y 1 B GLN 61 ? B GLN 6 58 1 Y 1 B GLU 62 ? B GLU 7 59 1 Y 1 B GLU 63 ? B GLU 8 60 1 Y 1 B GLU 64 ? B GLU 9 61 1 Y 1 B GLU 65 ? B GLU 10 62 1 Y 1 B VAL 66 ? B VAL 11 63 1 Y 1 B GLY 67 ? B GLY 12 64 1 Y 1 B PHE 68 ? B PHE 13 65 1 Y 1 B PRO 69 ? B PRO 14 66 1 Y 1 B VAL 70 ? B VAL 15 67 1 Y 1 B GLU 149 ? B GLU 94 68 1 Y 1 B PRO 150 ? B PRO 95 69 1 Y 1 B ASP 151 ? B ASP 96 70 1 Y 1 B LYS 152 ? B LYS 97 71 1 Y 1 B VAL 153 ? B VAL 98 72 1 Y 1 B GLU 154 ? B GLU 99 73 1 Y 1 B GLU 155 ? B GLU 100 74 1 Y 1 B ALA 156 ? B ALA 101 75 1 Y 1 B ASN 157 ? B ASN 102 76 1 Y 1 B LYS 158 ? B LYS 103 77 1 Y 1 B GLY 159 ? B GLY 104 78 1 Y 1 B GLU 160 ? B GLU 105 79 1 Y 1 B ASN 161 ? B ASN 106 80 1 Y 1 B THR 162 ? B THR 107 81 1 Y 1 B SER 163 ? B SER 108 82 1 Y 1 B LEU 164 ? B LEU 109 83 1 Y 1 B LEU 165 ? B LEU 110 84 1 Y 1 B HIS 166 ? B HIS 111 85 1 Y 1 B PRO 167 ? B PRO 112 86 1 Y 1 B VAL 168 ? B VAL 113 87 1 Y 1 B SER 169 ? B SER 114 88 1 Y 1 B LEU 170 ? B LEU 115 89 1 Y 1 B HIS 171 ? B HIS 116 90 1 Y 1 B GLY 172 ? B GLY 117 91 1 Y 1 B MET 173 ? B MET 118 92 1 Y 1 B ASP 174 ? B ASP 119 93 1 Y 1 B ASP 175 ? B ASP 120 94 1 Y 1 B PRO 176 ? B PRO 121 95 1 Y 1 B GLU 177 ? B GLU 122 96 1 Y 1 B ARG 178 ? B ARG 123 97 1 Y 1 B LYS 204 ? B LYS 149 98 1 Y 1 B ASN 205 ? B ASN 150 99 1 Y 1 B CYS 206 ? B CYS 151 # loop_ _pdbx_initial_refinement_model.id _pdbx_initial_refinement_model.entity_id_list _pdbx_initial_refinement_model.type _pdbx_initial_refinement_model.source_name _pdbx_initial_refinement_model.accession_code _pdbx_initial_refinement_model.details 1 ? 'experimental model' PDB 1EFN 'PDB ENTRIES 1EFN AND 1SHF' 2 ? 'experimental model' PDB 1SHF 'PDB ENTRIES 1EFN AND 1SHF' #