data_1BAJ # _entry.id 1BAJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1BAJ pdb_00001baj 10.2210/pdb1baj/pdb WWPDB D_1000171528 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BAJ _pdbx_database_status.recvd_initial_deposition_date 1998-04-17 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Worthylake, D.K.' 1 'Wang, H.' 2 'Yoo, S.' 3 'Sundquist, W.I.' 4 'Hill, C.P.' 5 # _citation.id primary _citation.title 'Structures of the HIV-1 capsid protein dimerization domain at 2.6 A resolution.' _citation.journal_abbrev 'Acta Crystallogr.,Sect.D' _citation.journal_volume 55 _citation.page_first 85 _citation.page_last 92 _citation.year 1999 _citation.journal_id_ASTM ABCRE6 _citation.country DK _citation.journal_id_ISSN 0907-4449 _citation.journal_id_CSD 0766 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10089398 _citation.pdbx_database_id_DOI 10.1107/S0907444998007689 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Worthylake, D.K.' 1 ? primary 'Wang, H.' 2 ? primary 'Yoo, S.' 3 ? primary 'Sundquist, W.I.' 4 ? primary 'Hill, C.P.' 5 ? # _cell.entry_id 1BAJ _cell.length_a 61.330 _cell.length_b 61.330 _cell.length_c 59.570 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BAJ _symmetry.space_group_name_H-M 'I 41' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 80 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'GAG POLYPROTEIN' 11107.775 1 ? ? 'C-TERMINAL DOMAIN OF HIV-1 CAPSID PROTEIN (RESIDUES 146-229 CAPSID NUMBERING) FOLLOWED BY THE 14 AMINO ACID P2 DOMAIN OF GAG' ? 2 water nat water 18.015 27 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGP GHKARVLAEAMSQVTNPATIM ; _entity_poly.pdbx_seq_one_letter_code_can ;MSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGP GHKARVLAEAMSQVTNPATIM ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 PRO n 1 4 THR n 1 5 SER n 1 6 ILE n 1 7 LEU n 1 8 ASP n 1 9 ILE n 1 10 ARG n 1 11 GLN n 1 12 GLY n 1 13 PRO n 1 14 LYS n 1 15 GLU n 1 16 PRO n 1 17 PHE n 1 18 ARG n 1 19 ASP n 1 20 TYR n 1 21 VAL n 1 22 ASP n 1 23 ARG n 1 24 PHE n 1 25 TYR n 1 26 LYS n 1 27 THR n 1 28 LEU n 1 29 ARG n 1 30 ALA n 1 31 GLU n 1 32 GLN n 1 33 ALA n 1 34 SER n 1 35 GLN n 1 36 GLU n 1 37 VAL n 1 38 LYS n 1 39 ASN n 1 40 TRP n 1 41 MET n 1 42 THR n 1 43 GLU n 1 44 THR n 1 45 LEU n 1 46 LEU n 1 47 VAL n 1 48 GLN n 1 49 ASN n 1 50 ALA n 1 51 ASN n 1 52 PRO n 1 53 ASP n 1 54 CYS n 1 55 LYS n 1 56 THR n 1 57 ILE n 1 58 LEU n 1 59 LYS n 1 60 ALA n 1 61 LEU n 1 62 GLY n 1 63 PRO n 1 64 GLY n 1 65 ALA n 1 66 THR n 1 67 LEU n 1 68 GLU n 1 69 GLU n 1 70 MET n 1 71 MET n 1 72 THR n 1 73 ALA n 1 74 CYS n 1 75 GLN n 1 76 GLY n 1 77 VAL n 1 78 GLY n 1 79 GLY n 1 80 PRO n 1 81 GLY n 1 82 HIS n 1 83 LYS n 1 84 ALA n 1 85 ARG n 1 86 VAL n 1 87 LEU n 1 88 ALA n 1 89 GLU n 1 90 ALA n 1 91 MET n 1 92 SER n 1 93 GLN n 1 94 VAL n 1 95 THR n 1 96 ASN n 1 97 PRO n 1 98 ALA n 1 99 THR n 1 100 ILE n 1 101 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Lentivirus _entity_src_gen.pdbx_gene_src_gene GAG _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11676 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene GAG _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name BL21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POL_HV1N5 _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P12497 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNT IAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNYPIVQNLQGQMVHQAISPRTLNAWVKVVEE KAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTS TLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETL LVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVLAEAMSQVTNPATIMIQKGNFRNQRKTVKCFNCGKEGHI AKNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSHKGRPGNFLQSRPEPTAPPEESFRFGEETTTPSQKQEPIDK ELYPLASLRSLFGSDPSSQ ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BAJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 101 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P12497 _struct_ref_seq.db_align_beg 275 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 376 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 145 _struct_ref_seq.pdbx_auth_seq_align_end 245 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1BAJ _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P12497 _struct_ref_seq_dif.db_mon_id TYR _struct_ref_seq_dif.pdbx_seq_db_seq_num 276 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 145 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1BAJ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 3 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.52 _exptl_crystal.density_percent_sol 51.3 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 5.0' # _diffrn.id 1 _diffrn.ambient_temp 300 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 1997-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X8C' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X8C _diffrn_source.pdbx_wavelength 1.0 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1BAJ _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20 _reflns.d_resolution_high 2.6 _reflns.number_obs 3227 _reflns.number_all ? _reflns.percent_possible_obs 92.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 16.2 _reflns.B_iso_Wilson_estimate 56.6 _reflns.pdbx_redundancy ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.6 _reflns_shell.d_res_low 2.69 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 7.9 _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1BAJ _refine.ls_number_reflns_obs 3200 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 10000000.00 _refine.pdbx_data_cutoff_low_absF 0.00100 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.00 _refine.ls_d_res_high 2.60 _refine.ls_percent_reflns_obs 92.9 _refine.ls_R_factor_obs 0.207 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.207 _refine.ls_R_factor_R_free 0.275 _refine.ls_R_factor_R_free_error 0.015 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.9 _refine.ls_number_reflns_R_free 349 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 66.9 _refine.aniso_B[1][1] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[3][3] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'BULK SOLVENT MODEL USED' _refine.pdbx_starting_model 1AM3 _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1BAJ _refine_analyze.Luzzati_coordinate_error_obs 0.30 _refine_analyze.Luzzati_sigma_a_obs 0.41 _refine_analyze.Luzzati_d_res_low_obs 20.0 _refine_analyze.Luzzati_coordinate_error_free 0.38 _refine_analyze.Luzzati_sigma_a_free 0.20 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 564 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 27 _refine_hist.number_atoms_total 591 _refine_hist.d_res_high 2.60 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.3 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 21.7 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.23 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it 3.61 1.50 ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it 5.91 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scbond_it 6.51 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scangle_it 10.74 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.60 _refine_ls_shell.d_res_low 2.76 _refine_ls_shell.number_reflns_R_work 519 _refine_ls_shell.R_factor_R_work 0.362 _refine_ls_shell.percent_reflns_obs 100.0 _refine_ls_shell.R_factor_R_free 0.298 _refine_ls_shell.R_factor_R_free_error 0.041 _refine_ls_shell.percent_reflns_R_free 9.3 _refine_ls_shell.number_reflns_R_free 53 _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 1BAJ _struct.title 'HIV-1 CAPSID PROTEIN C-TERMINAL FRAGMENT PLUS GAG P2 DOMAIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BAJ _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'CAPSID, HIV-1 ASSEMBLY PROTEIN, Viral protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 5 ? ASP A 8 ? SER A 149 ASP A 152 5 ? 4 HELX_P HELX_P2 2 PHE A 17 ? ALA A 30 ? PHE A 161 ALA A 174 1 ? 14 HELX_P HELX_P3 3 GLN A 35 ? GLU A 43 ? GLN A 179 GLU A 187 1 ? 9 HELX_P HELX_P4 4 LEU A 45 ? GLN A 48 ? LEU A 189 GLN A 192 1 ? 4 HELX_P HELX_P5 5 PRO A 52 ? LEU A 61 ? PRO A 196 LEU A 205 1 ? 10 HELX_P HELX_P6 6 LEU A 67 ? THR A 72 ? LEU A 211 THR A 216 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 54 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 74 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 198 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 218 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.043 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1BAJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1BAJ _atom_sites.fract_transf_matrix[1][1] 0.016305 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016305 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016787 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 145 ? ? ? A . n A 1 2 SER 2 146 ? ? ? A . n A 1 3 PRO 3 147 ? ? ? A . n A 1 4 THR 4 148 148 THR THR A . n A 1 5 SER 5 149 149 SER SER A . n A 1 6 ILE 6 150 150 ILE ILE A . n A 1 7 LEU 7 151 151 LEU LEU A . n A 1 8 ASP 8 152 152 ASP ASP A . n A 1 9 ILE 9 153 153 ILE ILE A . n A 1 10 ARG 10 154 154 ARG ARG A . n A 1 11 GLN 11 155 155 GLN GLN A . n A 1 12 GLY 12 156 156 GLY GLY A . n A 1 13 PRO 13 157 157 PRO PRO A . n A 1 14 LYS 14 158 158 LYS LYS A . n A 1 15 GLU 15 159 159 GLU GLU A . n A 1 16 PRO 16 160 160 PRO PRO A . n A 1 17 PHE 17 161 161 PHE PHE A . n A 1 18 ARG 18 162 162 ARG ARG A . n A 1 19 ASP 19 163 163 ASP ASP A . n A 1 20 TYR 20 164 164 TYR TYR A . n A 1 21 VAL 21 165 165 VAL VAL A . n A 1 22 ASP 22 166 166 ASP ASP A . n A 1 23 ARG 23 167 167 ARG ARG A . n A 1 24 PHE 24 168 168 PHE PHE A . n A 1 25 TYR 25 169 169 TYR TYR A . n A 1 26 LYS 26 170 170 LYS LYS A . n A 1 27 THR 27 171 171 THR THR A . n A 1 28 LEU 28 172 172 LEU LEU A . n A 1 29 ARG 29 173 173 ARG ARG A . n A 1 30 ALA 30 174 174 ALA ALA A . n A 1 31 GLU 31 175 175 GLU GLU A . n A 1 32 GLN 32 176 176 GLN GLN A . n A 1 33 ALA 33 177 177 ALA ALA A . n A 1 34 SER 34 178 178 SER SER A . n A 1 35 GLN 35 179 179 GLN GLN A . n A 1 36 GLU 36 180 180 GLU GLU A . n A 1 37 VAL 37 181 181 VAL VAL A . n A 1 38 LYS 38 182 182 LYS LYS A . n A 1 39 ASN 39 183 183 ASN ASN A . n A 1 40 TRP 40 184 184 TRP TRP A . n A 1 41 MET 41 185 185 MET MET A . n A 1 42 THR 42 186 186 THR THR A . n A 1 43 GLU 43 187 187 GLU GLU A . n A 1 44 THR 44 188 188 THR THR A . n A 1 45 LEU 45 189 189 LEU LEU A . n A 1 46 LEU 46 190 190 LEU LEU A . n A 1 47 VAL 47 191 191 VAL VAL A . n A 1 48 GLN 48 192 192 GLN GLN A . n A 1 49 ASN 49 193 193 ASN ASN A . n A 1 50 ALA 50 194 194 ALA ALA A . n A 1 51 ASN 51 195 195 ASN ASN A . n A 1 52 PRO 52 196 196 PRO PRO A . n A 1 53 ASP 53 197 197 ASP ASP A . n A 1 54 CYS 54 198 198 CYS CYS A . n A 1 55 LYS 55 199 199 LYS LYS A . n A 1 56 THR 56 200 200 THR THR A . n A 1 57 ILE 57 201 201 ILE ILE A . n A 1 58 LEU 58 202 202 LEU LEU A . n A 1 59 LYS 59 203 203 LYS LYS A . n A 1 60 ALA 60 204 204 ALA ALA A . n A 1 61 LEU 61 205 205 LEU LEU A . n A 1 62 GLY 62 206 206 GLY GLY A . n A 1 63 PRO 63 207 207 PRO PRO A . n A 1 64 GLY 64 208 208 GLY GLY A . n A 1 65 ALA 65 209 209 ALA ALA A . n A 1 66 THR 66 210 210 THR THR A . n A 1 67 LEU 67 211 211 LEU LEU A . n A 1 68 GLU 68 212 212 GLU GLU A . n A 1 69 GLU 69 213 213 GLU GLU A . n A 1 70 MET 70 214 214 MET MET A . n A 1 71 MET 71 215 215 MET MET A . n A 1 72 THR 72 216 216 THR THR A . n A 1 73 ALA 73 217 217 ALA ALA A . n A 1 74 CYS 74 218 218 CYS CYS A . n A 1 75 GLN 75 219 ? ? ? A . n A 1 76 GLY 76 220 ? ? ? A . n A 1 77 VAL 77 221 ? ? ? A . n A 1 78 GLY 78 222 ? ? ? A . n A 1 79 GLY 79 223 ? ? ? A . n A 1 80 PRO 80 224 ? ? ? A . n A 1 81 GLY 81 225 ? ? ? A . n A 1 82 HIS 82 226 ? ? ? A . n A 1 83 LYS 83 227 ? ? ? A . n A 1 84 ALA 84 228 ? ? ? A . n A 1 85 ARG 85 229 ? ? ? A . n A 1 86 VAL 86 230 ? ? ? A . n A 1 87 LEU 87 231 ? ? ? A . n A 1 88 ALA 88 232 ? ? ? A . n A 1 89 GLU 89 233 ? ? ? A . n A 1 90 ALA 90 234 ? ? ? A . n A 1 91 MET 91 235 ? ? ? A . n A 1 92 SER 92 236 ? ? ? A . n A 1 93 GLN 93 237 ? ? ? A . n A 1 94 VAL 94 238 ? ? ? A . n A 1 95 THR 95 239 ? ? ? A . n A 1 96 ASN 96 240 ? ? ? A . n A 1 97 PRO 97 241 ? ? ? A . n A 1 98 ALA 98 242 ? ? ? A . n A 1 99 THR 99 243 ? ? ? A . n A 1 100 ILE 100 244 ? ? ? A . n A 1 101 MET 101 245 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 401 401 HOH HOH A . B 2 HOH 2 402 402 HOH HOH A . B 2 HOH 3 403 403 HOH HOH A . B 2 HOH 4 404 404 HOH HOH A . B 2 HOH 5 405 405 HOH HOH A . B 2 HOH 6 406 406 HOH HOH A . B 2 HOH 7 407 407 HOH HOH A . B 2 HOH 8 408 408 HOH HOH A . B 2 HOH 9 409 409 HOH HOH A . B 2 HOH 10 410 410 HOH HOH A . B 2 HOH 11 411 411 HOH HOH A . B 2 HOH 12 412 412 HOH HOH A . B 2 HOH 13 413 413 HOH HOH A . B 2 HOH 14 414 414 HOH HOH A . B 2 HOH 15 415 415 HOH HOH A . B 2 HOH 16 416 416 HOH HOH A . B 2 HOH 17 417 417 HOH HOH A . B 2 HOH 18 418 418 HOH HOH A . B 2 HOH 19 419 419 HOH HOH A . B 2 HOH 20 420 420 HOH HOH A . B 2 HOH 21 421 421 HOH HOH A . B 2 HOH 22 422 422 HOH HOH A . B 2 HOH 23 423 423 HOH HOH A . B 2 HOH 24 424 424 HOH HOH A . B 2 HOH 25 425 425 HOH HOH A . B 2 HOH 26 426 426 HOH HOH A . B 2 HOH 27 427 427 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 61.3300000000 0.0000000000 -1.0000000000 0.0000000000 61.3300000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-10-14 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-08-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_initial_refinement_model 3 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 AMoRE phasing . ? 3 X-PLOR refinement 3.843 ? 4 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id THR _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 188 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -126.98 _pdbx_validate_torsion.psi -87.14 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 145 ? A MET 1 2 1 Y 1 A SER 146 ? A SER 2 3 1 Y 1 A PRO 147 ? A PRO 3 4 1 Y 1 A GLN 219 ? A GLN 75 5 1 Y 1 A GLY 220 ? A GLY 76 6 1 Y 1 A VAL 221 ? A VAL 77 7 1 Y 1 A GLY 222 ? A GLY 78 8 1 Y 1 A GLY 223 ? A GLY 79 9 1 Y 1 A PRO 224 ? A PRO 80 10 1 Y 1 A GLY 225 ? A GLY 81 11 1 Y 1 A HIS 226 ? A HIS 82 12 1 Y 1 A LYS 227 ? A LYS 83 13 1 Y 1 A ALA 228 ? A ALA 84 14 1 Y 1 A ARG 229 ? A ARG 85 15 1 Y 1 A VAL 230 ? A VAL 86 16 1 Y 1 A LEU 231 ? A LEU 87 17 1 Y 1 A ALA 232 ? A ALA 88 18 1 Y 1 A GLU 233 ? A GLU 89 19 1 Y 1 A ALA 234 ? A ALA 90 20 1 Y 1 A MET 235 ? A MET 91 21 1 Y 1 A SER 236 ? A SER 92 22 1 Y 1 A GLN 237 ? A GLN 93 23 1 Y 1 A VAL 238 ? A VAL 94 24 1 Y 1 A THR 239 ? A THR 95 25 1 Y 1 A ASN 240 ? A ASN 96 26 1 Y 1 A PRO 241 ? A PRO 97 27 1 Y 1 A ALA 242 ? A ALA 98 28 1 Y 1 A THR 243 ? A THR 99 29 1 Y 1 A ILE 244 ? A ILE 100 30 1 Y 1 A MET 245 ? A MET 101 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1AM3 _pdbx_initial_refinement_model.details ? #