data_1BG7 # _entry.id 1BG7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1BG7 pdb_00001bg7 10.2210/pdb1bg7/pdb WWPDB D_1000171717 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BG7 _pdbx_database_status.recvd_initial_deposition_date 1998-06-05 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Takagi, H.' 1 'Shi, D.' 2 'Ha, Y.' 3 'Allewell, N.M.' 4 'Theil, E.C.' 5 # _citation.id primary _citation.title 'Localized unfolding at the junction of three ferritin subunits. A mechanism for iron release?' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 273 _citation.page_first 18685 _citation.page_last 18688 _citation.year 1998 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9668036 _citation.pdbx_database_id_DOI 10.1074/jbc.273.30.18685 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Takagi, H.' 1 ? primary 'Shi, D.' 2 ? primary 'Ha, Y.' 3 ? primary 'Allewell, N.M.' 4 ? primary 'Theil, E.C.' 5 ? # _cell.entry_id 1BG7 _cell.length_a 182.800 _cell.length_b 182.800 _cell.length_c 182.800 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 96 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BG7 _symmetry.space_group_name_H-M 'F 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 209 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man FERRITIN 20546.098 1 ? 'K82Q, L134P' ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 water nat water 18.015 32 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDSQVRQNFHRDCEAAINRMVNMELYASYTYLSMAFYFDRDDIALHNVAKFFKEQSHEEREHAEKLMKDQNKRGGRIVLQ DVQKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKVGSDKVDPHLCDFLETEYPEEQVKSIKQLGDYITNLKRLGLPQN GMGEYLFDKHTMGESS ; _entity_poly.pdbx_seq_one_letter_code_can ;MDSQVRQNFHRDCEAAINRMVNMELYASYTYLSMAFYFDRDDIALHNVAKFFKEQSHEEREHAEKLMKDQNKRGGRIVLQ DVQKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKVGSDKVDPHLCDFLETEYPEEQVKSIKQLGDYITNLKRLGLPQN GMGEYLFDKHTMGESS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 SER n 1 4 GLN n 1 5 VAL n 1 6 ARG n 1 7 GLN n 1 8 ASN n 1 9 PHE n 1 10 HIS n 1 11 ARG n 1 12 ASP n 1 13 CYS n 1 14 GLU n 1 15 ALA n 1 16 ALA n 1 17 ILE n 1 18 ASN n 1 19 ARG n 1 20 MET n 1 21 VAL n 1 22 ASN n 1 23 MET n 1 24 GLU n 1 25 LEU n 1 26 TYR n 1 27 ALA n 1 28 SER n 1 29 TYR n 1 30 THR n 1 31 TYR n 1 32 LEU n 1 33 SER n 1 34 MET n 1 35 ALA n 1 36 PHE n 1 37 TYR n 1 38 PHE n 1 39 ASP n 1 40 ARG n 1 41 ASP n 1 42 ASP n 1 43 ILE n 1 44 ALA n 1 45 LEU n 1 46 HIS n 1 47 ASN n 1 48 VAL n 1 49 ALA n 1 50 LYS n 1 51 PHE n 1 52 PHE n 1 53 LYS n 1 54 GLU n 1 55 GLN n 1 56 SER n 1 57 HIS n 1 58 GLU n 1 59 GLU n 1 60 ARG n 1 61 GLU n 1 62 HIS n 1 63 ALA n 1 64 GLU n 1 65 LYS n 1 66 LEU n 1 67 MET n 1 68 LYS n 1 69 ASP n 1 70 GLN n 1 71 ASN n 1 72 LYS n 1 73 ARG n 1 74 GLY n 1 75 GLY n 1 76 ARG n 1 77 ILE n 1 78 VAL n 1 79 LEU n 1 80 GLN n 1 81 ASP n 1 82 VAL n 1 83 GLN n 1 84 LYS n 1 85 PRO n 1 86 GLU n 1 87 ARG n 1 88 ASP n 1 89 GLU n 1 90 TRP n 1 91 GLY n 1 92 ASN n 1 93 THR n 1 94 LEU n 1 95 GLU n 1 96 ALA n 1 97 MET n 1 98 GLN n 1 99 ALA n 1 100 ALA n 1 101 LEU n 1 102 GLN n 1 103 LEU n 1 104 GLU n 1 105 LYS n 1 106 THR n 1 107 VAL n 1 108 ASN n 1 109 GLN n 1 110 ALA n 1 111 LEU n 1 112 LEU n 1 113 ASP n 1 114 LEU n 1 115 HIS n 1 116 LYS n 1 117 VAL n 1 118 GLY n 1 119 SER n 1 120 ASP n 1 121 LYS n 1 122 VAL n 1 123 ASP n 1 124 PRO n 1 125 HIS n 1 126 LEU n 1 127 CYS n 1 128 ASP n 1 129 PHE n 1 130 LEU n 1 131 GLU n 1 132 THR n 1 133 GLU n 1 134 TYR n 1 135 PRO n 1 136 GLU n 1 137 GLU n 1 138 GLN n 1 139 VAL n 1 140 LYS n 1 141 SER n 1 142 ILE n 1 143 LYS n 1 144 GLN n 1 145 LEU n 1 146 GLY n 1 147 ASP n 1 148 TYR n 1 149 ILE n 1 150 THR n 1 151 ASN n 1 152 LEU n 1 153 LYS n 1 154 ARG n 1 155 LEU n 1 156 GLY n 1 157 LEU n 1 158 PRO n 1 159 GLN n 1 160 ASN n 1 161 GLY n 1 162 MET n 1 163 GLY n 1 164 GLU n 1 165 TYR n 1 166 LEU n 1 167 PHE n 1 168 ASP n 1 169 LYS n 1 170 HIS n 1 171 THR n 1 172 MET n 1 173 GLY n 1 174 GLU n 1 175 SER n 1 176 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name bullfrog _entity_src_gen.gene_src_genus Rana _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain BL21-DE3 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rana catesbeiana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 8400 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PET-9A _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name BL21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FRI1_RANCA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P07229 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MDSQVRQNFHRDCEAAINRMVNMELYASYTYLSMAFYFDRDDIALHNVAKFFKEQSHEEREHAEKLMKDQNKRGGRIVLQ DVKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKVGSDKVDPHLCDFLETEYLEEQVKSIKQLGDYITNLKRLGLPQN GMGEYLFDKHTMGESS ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BG7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 176 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07229 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 176 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 175 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1BG7 GLN A 83 ? UNP P07229 LYS 83 'engineered mutation' 82 1 1 1BG7 PRO A 135 ? UNP P07229 LEU 135 'engineered mutation' 134 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1BG7 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.6 _exptl_crystal.density_percent_sol 63 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 4.6' # _diffrn.id 1 _diffrn.ambient_temp 120 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'CCD AREA DETECTOR' _diffrn_detector.type SIEMENS _diffrn_detector.pdbx_collection_date 1998-02 _diffrn_detector.details COLLIMATOR # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI(111)' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.10 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X12C' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X12C _diffrn_source.pdbx_wavelength 1.10 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1BG7 _reflns.observed_criterion_sigma_I 2 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low ? _reflns.d_resolution_high 1.8 _reflns.number_obs 1179393 _reflns.number_all ? _reflns.percent_possible_obs 99.2 _reflns.pdbx_Rmerge_I_obs 0.0780000 _reflns.pdbx_Rsym_value 0.0780000 _reflns.pdbx_netI_over_sigmaI 37 _reflns.B_iso_Wilson_estimate 30.5 _reflns.pdbx_redundancy 60.0 _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.81 _reflns_shell.d_res_low 1.89 _reflns_shell.percent_possible_all 98.1 _reflns_shell.Rmerge_I_obs 0.1070000 _reflns_shell.pdbx_Rsym_value 0.1070000 _reflns_shell.meanI_over_sigI_obs 0.8 _reflns_shell.pdbx_redundancy 50 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1BG7 _refine.ls_number_reflns_obs 21668 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF 100000 _refine.pdbx_data_cutoff_low_absF 0.001 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 40.0 _refine.ls_d_res_high 1.85 _refine.ls_percent_reflns_obs 98.0 _refine.ls_R_factor_obs 0.2070000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2070000 _refine.ls_R_factor_R_free 0.2330000 _refine.ls_R_factor_R_free_error 0.017 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.8 _refine.ls_number_reflns_R_free 2400 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 30.3 _refine.aniso_B[1][1] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[3][3] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 1FHA _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINTS _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1BG7 _refine_analyze.Luzzati_coordinate_error_obs 0.02 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs 40.0 _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1234 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 32 _refine_hist.number_atoms_total 1267 _refine_hist.d_res_high 1.85 _refine_hist.d_res_low 40.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.012 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 2.5 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 20.1 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 0.93 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it 2.5 2.9 ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it 3.6 3.8 ? ? 'X-RAY DIFFRACTION' ? x_scbond_it 5.0 5.3 ? ? 'X-RAY DIFFRACTION' ? x_scangle_it 7.6 7.9 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.d_res_high 1.85 _refine_ls_shell.d_res_low 1.93 _refine_ls_shell.number_reflns_R_work 2226 _refine_ls_shell.R_factor_R_work 0.3550000 _refine_ls_shell.percent_reflns_obs 98.0 _refine_ls_shell.R_factor_R_free 0.3500000 _refine_ls_shell.R_factor_R_free_error 0.042 _refine_ls_shell.percent_reflns_R_free 9.8 _refine_ls_shell.number_reflns_R_free 255 _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARAM19X.PRO TOPH19X.PRO 'X-RAY DIFFRACTION' 2 ? ? 'X-RAY DIFFRACTION' # _struct.entry_id 1BG7 _struct.title 'LOCALIZED UNFOLDING AT THE JUNCTION OF THREE FERRITIN SUBUNITS. A MECHANISM FOR IRON RELEASE?' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BG7 _struct_keywords.pdbx_keywords 'IRON STORAGE' _struct_keywords.text 'FERRITIN, IRON STORAGE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 11 ? PHE A 38 ? ARG A 10 PHE A 37 1 ? 28 HELX_P HELX_P2 2 HIS A 46 ? ARG A 73 ? HIS A 45 ARG A 72 1 ? 28 HELX_P HELX_P3 3 THR A 93 ? LEU A 112 ? THR A 92 LEU A 111 1 ? 20 HELX_P HELX_P4 4 GLN A 138 ? ARG A 154 ? GLN A 137 ARG A 153 1 ? 17 HELX_P HELX_P5 5 GLY A 161 ? HIS A 170 ? GLY A 160 HIS A 169 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 81 OD1 ? ? ? 22_555 B CA . CA ? ? A ASP 80 A CA 176 1_555 ? ? ? ? ? ? ? 2.791 ? ? metalc2 metalc ? ? A ASP 81 OD1 ? ? ? 51_555 B CA . CA ? ? A ASP 80 A CA 176 1_555 ? ? ? ? ? ? ? 2.791 ? ? metalc3 metalc ? ? A ASP 81 OD2 ? ? ? 22_555 B CA . CA ? ? A ASP 80 A CA 176 1_555 ? ? ? ? ? ? ? 2.289 ? ? metalc4 metalc ? ? A ASP 81 OD2 ? ? ? 51_555 B CA . CA ? ? A ASP 80 A CA 176 1_555 ? ? ? ? ? ? ? 2.289 ? ? metalc5 metalc ? ? A GLN 83 NE2 ? ? ? 1_555 B CA . CA ? ? A GLN 82 A CA 176 1_555 ? ? ? ? ? ? ? 2.351 ? ? metalc6 metalc ? ? A GLN 83 NE2 ? ? ? 72_555 B CA . CA ? ? A GLN 82 A CA 176 1_555 ? ? ? ? ? ? ? 2.351 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 157 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 156 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 158 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 157 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 10.48 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CA _struct_site.pdbx_auth_seq_id 176 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE CA A 176' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ASP A 81 ? ASP A 80 . ? 22_555 ? 2 AC1 4 ASP A 81 ? ASP A 80 . ? 51_555 ? 3 AC1 4 GLN A 83 ? GLN A 82 . ? 72_555 ? 4 AC1 4 GLN A 83 ? GLN A 82 . ? 1_555 ? # _database_PDB_matrix.entry_id 1BG7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1BG7 _atom_sites.fract_transf_matrix[1][1] 0.005470 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005470 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005470 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 ASP 2 1 1 ASP ASP A . n A 1 3 SER 3 2 2 SER SER A . n A 1 4 GLN 4 3 3 GLN GLN A . n A 1 5 VAL 5 4 4 VAL VAL A . n A 1 6 ARG 6 5 5 ARG ARG A . n A 1 7 GLN 7 6 6 GLN GLN A . n A 1 8 ASN 8 7 7 ASN ASN A . n A 1 9 PHE 9 8 8 PHE PHE A . n A 1 10 HIS 10 9 9 HIS HIS A . n A 1 11 ARG 11 10 10 ARG ARG A . n A 1 12 ASP 12 11 11 ASP ASP A . n A 1 13 CYS 13 12 12 CYS CYS A . n A 1 14 GLU 14 13 13 GLU GLU A . n A 1 15 ALA 15 14 14 ALA ALA A . n A 1 16 ALA 16 15 15 ALA ALA A . n A 1 17 ILE 17 16 16 ILE ILE A . n A 1 18 ASN 18 17 17 ASN ASN A . n A 1 19 ARG 19 18 18 ARG ARG A . n A 1 20 MET 20 19 19 MET MET A . n A 1 21 VAL 21 20 20 VAL VAL A . n A 1 22 ASN 22 21 21 ASN ASN A . n A 1 23 MET 23 22 22 MET MET A . n A 1 24 GLU 24 23 23 GLU GLU A . n A 1 25 LEU 25 24 24 LEU LEU A . n A 1 26 TYR 26 25 25 TYR TYR A . n A 1 27 ALA 27 26 26 ALA ALA A . n A 1 28 SER 28 27 27 SER SER A . n A 1 29 TYR 29 28 28 TYR TYR A . n A 1 30 THR 30 29 29 THR THR A . n A 1 31 TYR 31 30 30 TYR TYR A . n A 1 32 LEU 32 31 31 LEU LEU A . n A 1 33 SER 33 32 32 SER SER A . n A 1 34 MET 34 33 33 MET MET A . n A 1 35 ALA 35 34 34 ALA ALA A . n A 1 36 PHE 36 35 35 PHE PHE A . n A 1 37 TYR 37 36 36 TYR TYR A . n A 1 38 PHE 38 37 37 PHE PHE A . n A 1 39 ASP 39 38 38 ASP ASP A . n A 1 40 ARG 40 39 39 ARG ARG A . n A 1 41 ASP 41 40 40 ASP ASP A . n A 1 42 ASP 42 41 41 ASP ASP A . n A 1 43 ILE 43 42 42 ILE ILE A . n A 1 44 ALA 44 43 43 ALA ALA A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 HIS 46 45 45 HIS HIS A . n A 1 47 ASN 47 46 46 ASN ASN A . n A 1 48 VAL 48 47 47 VAL VAL A . n A 1 49 ALA 49 48 48 ALA ALA A . n A 1 50 LYS 50 49 49 LYS LYS A . n A 1 51 PHE 51 50 50 PHE PHE A . n A 1 52 PHE 52 51 51 PHE PHE A . n A 1 53 LYS 53 52 52 LYS LYS A . n A 1 54 GLU 54 53 53 GLU GLU A . n A 1 55 GLN 55 54 54 GLN GLN A . n A 1 56 SER 56 55 55 SER SER A . n A 1 57 HIS 57 56 56 HIS HIS A . n A 1 58 GLU 58 57 57 GLU GLU A . n A 1 59 GLU 59 58 58 GLU GLU A . n A 1 60 ARG 60 59 59 ARG ARG A . n A 1 61 GLU 61 60 60 GLU GLU A . n A 1 62 HIS 62 61 61 HIS HIS A . n A 1 63 ALA 63 62 62 ALA ALA A . n A 1 64 GLU 64 63 63 GLU GLU A . n A 1 65 LYS 65 64 64 LYS LYS A . n A 1 66 LEU 66 65 65 LEU LEU A . n A 1 67 MET 67 66 66 MET MET A . n A 1 68 LYS 68 67 67 LYS LYS A . n A 1 69 ASP 69 68 68 ASP ASP A . n A 1 70 GLN 70 69 69 GLN GLN A . n A 1 71 ASN 71 70 70 ASN ASN A . n A 1 72 LYS 72 71 71 LYS LYS A . n A 1 73 ARG 73 72 72 ARG ARG A . n A 1 74 GLY 74 73 73 GLY GLY A . n A 1 75 GLY 75 74 74 GLY GLY A . n A 1 76 ARG 76 75 75 ARG ARG A . n A 1 77 ILE 77 76 76 ILE ILE A . n A 1 78 VAL 78 77 77 VAL VAL A . n A 1 79 LEU 79 78 78 LEU LEU A . n A 1 80 GLN 80 79 79 GLN GLN A . n A 1 81 ASP 81 80 80 ASP ASP A . n A 1 82 VAL 82 81 81 VAL VAL A . n A 1 83 GLN 83 82 82 GLN GLN A . n A 1 84 LYS 84 83 83 LYS LYS A . n A 1 85 PRO 85 84 84 PRO PRO A . n A 1 86 GLU 86 85 85 GLU GLU A . n A 1 87 ARG 87 86 86 ARG ARG A . n A 1 88 ASP 88 87 87 ASP ASP A . n A 1 89 GLU 89 88 88 GLU GLU A . n A 1 90 TRP 90 89 89 TRP TRP A . n A 1 91 GLY 91 90 90 GLY GLY A . n A 1 92 ASN 92 91 91 ASN ASN A . n A 1 93 THR 93 92 92 THR THR A . n A 1 94 LEU 94 93 93 LEU LEU A . n A 1 95 GLU 95 94 94 GLU GLU A . n A 1 96 ALA 96 95 95 ALA ALA A . n A 1 97 MET 97 96 96 MET MET A . n A 1 98 GLN 98 97 97 GLN GLN A . n A 1 99 ALA 99 98 98 ALA ALA A . n A 1 100 ALA 100 99 99 ALA ALA A . n A 1 101 LEU 101 100 100 LEU LEU A . n A 1 102 GLN 102 101 101 GLN GLN A . n A 1 103 LEU 103 102 102 LEU LEU A . n A 1 104 GLU 104 103 103 GLU GLU A . n A 1 105 LYS 105 104 104 LYS LYS A . n A 1 106 THR 106 105 105 THR THR A . n A 1 107 VAL 107 106 106 VAL VAL A . n A 1 108 ASN 108 107 107 ASN ASN A . n A 1 109 GLN 109 108 108 GLN GLN A . n A 1 110 ALA 110 109 109 ALA ALA A . n A 1 111 LEU 111 110 110 LEU LEU A . n A 1 112 LEU 112 111 111 LEU LEU A . n A 1 113 ASP 113 112 112 ASP ASP A . n A 1 114 LEU 114 113 113 LEU LEU A . n A 1 115 HIS 115 114 ? ? ? A . n A 1 116 LYS 116 115 ? ? ? A . n A 1 117 VAL 117 116 ? ? ? A . n A 1 118 GLY 118 117 ? ? ? A . n A 1 119 SER 119 118 ? ? ? A . n A 1 120 ASP 120 119 ? ? ? A . n A 1 121 LYS 121 120 ? ? ? A . n A 1 122 VAL 122 121 ? ? ? A . n A 1 123 ASP 123 122 ? ? ? A . n A 1 124 PRO 124 123 ? ? ? A . n A 1 125 HIS 125 124 ? ? ? A . n A 1 126 LEU 126 125 ? ? ? A . n A 1 127 CYS 127 126 ? ? ? A . n A 1 128 ASP 128 127 ? ? ? A . n A 1 129 PHE 129 128 ? ? ? A . n A 1 130 LEU 130 129 ? ? ? A . n A 1 131 GLU 131 130 ? ? ? A . n A 1 132 THR 132 131 ? ? ? A . n A 1 133 GLU 133 132 ? ? ? A . n A 1 134 TYR 134 133 ? ? ? A . n A 1 135 PRO 135 134 134 PRO PRO A . n A 1 136 GLU 136 135 135 GLU GLU A . n A 1 137 GLU 137 136 136 GLU GLU A . n A 1 138 GLN 138 137 137 GLN GLN A . n A 1 139 VAL 139 138 138 VAL VAL A . n A 1 140 LYS 140 139 139 LYS LYS A . n A 1 141 SER 141 140 140 SER SER A . n A 1 142 ILE 142 141 141 ILE ILE A . n A 1 143 LYS 143 142 142 LYS LYS A . n A 1 144 GLN 144 143 143 GLN GLN A . n A 1 145 LEU 145 144 144 LEU LEU A . n A 1 146 GLY 146 145 145 GLY GLY A . n A 1 147 ASP 147 146 146 ASP ASP A . n A 1 148 TYR 148 147 147 TYR TYR A . n A 1 149 ILE 149 148 148 ILE ILE A . n A 1 150 THR 150 149 149 THR THR A . n A 1 151 ASN 151 150 150 ASN ASN A . n A 1 152 LEU 152 151 151 LEU LEU A . n A 1 153 LYS 153 152 152 LYS LYS A . n A 1 154 ARG 154 153 153 ARG ARG A . n A 1 155 LEU 155 154 154 LEU LEU A . n A 1 156 GLY 156 155 155 GLY GLY A . n A 1 157 LEU 157 156 156 LEU LEU A . n A 1 158 PRO 158 157 157 PRO PRO A . n A 1 159 GLN 159 158 158 GLN GLN A . n A 1 160 ASN 160 159 159 ASN ASN A . n A 1 161 GLY 161 160 160 GLY GLY A . n A 1 162 MET 162 161 161 MET MET A . n A 1 163 GLY 163 162 162 GLY GLY A . n A 1 164 GLU 164 163 163 GLU GLU A . n A 1 165 TYR 165 164 164 TYR TYR A . n A 1 166 LEU 166 165 165 LEU LEU A . n A 1 167 PHE 167 166 166 PHE PHE A . n A 1 168 ASP 168 167 167 ASP ASP A . n A 1 169 LYS 169 168 168 LYS LYS A . n A 1 170 HIS 170 169 169 HIS HIS A . n A 1 171 THR 171 170 170 THR THR A . n A 1 172 MET 172 171 171 MET MET A . n A 1 173 GLY 173 172 172 GLY GLY A . n A 1 174 GLU 174 173 173 GLU GLU A . n A 1 175 SER 175 174 ? ? ? A . n A 1 176 SER 176 175 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 176 174 CA CA A . C 3 HOH 1 177 175 HOH HOH A . C 3 HOH 2 178 176 HOH HOH A . C 3 HOH 3 179 177 HOH HOH A . C 3 HOH 4 180 178 HOH HOH A . C 3 HOH 5 181 179 HOH HOH A . C 3 HOH 6 182 180 HOH HOH A . C 3 HOH 7 183 181 HOH HOH A . C 3 HOH 8 184 182 HOH HOH A . C 3 HOH 9 185 183 HOH HOH A . C 3 HOH 10 186 184 HOH HOH A . C 3 HOH 11 187 185 HOH HOH A . C 3 HOH 12 188 186 HOH HOH A . C 3 HOH 13 189 187 HOH HOH A . C 3 HOH 14 190 188 HOH HOH A . C 3 HOH 15 191 189 HOH HOH A . C 3 HOH 16 192 190 HOH HOH A . C 3 HOH 17 193 191 HOH HOH A . C 3 HOH 18 194 192 HOH HOH A . C 3 HOH 19 195 193 HOH HOH A . C 3 HOH 20 196 194 HOH HOH A . C 3 HOH 21 197 195 HOH HOH A . C 3 HOH 22 198 196 HOH HOH A . C 3 HOH 23 199 197 HOH HOH A . C 3 HOH 24 200 198 HOH HOH A . C 3 HOH 25 201 199 HOH HOH A . C 3 HOH 26 202 200 HOH HOH A . C 3 HOH 27 203 201 HOH HOH A . C 3 HOH 28 204 202 HOH HOH A . C 3 HOH 29 205 203 HOH HOH A . C 3 HOH 30 206 204 HOH HOH A . C 3 HOH 31 207 205 HOH HOH A . C 3 HOH 32 208 206 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 81850 ? 1 MORE -331 ? 1 'SSA (A^2)' 138520 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 -z,-x,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_555 -y,z,-x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 13 'crystal symmetry operation' 13_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 14 'crystal symmetry operation' 14_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 15 'crystal symmetry operation' 15_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 16 'crystal symmetry operation' 16_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 17 'crystal symmetry operation' 17_555 x,z,-y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 18 'crystal symmetry operation' 18_555 -x,z,y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 19 'crystal symmetry operation' 19_555 -x,-z,-y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 20 'crystal symmetry operation' 20_555 x,-z,y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 21 'crystal symmetry operation' 21_555 z,y,-x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 22 'crystal symmetry operation' 22_555 z,-y,x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 23 'crystal symmetry operation' 23_555 -z,y,x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 24 'crystal symmetry operation' 24_555 -z,-y,-x 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A CA 176 ? B CA . 2 1 A HOH 177 ? C HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 81 ? A ASP 80 ? 22_555 CA ? B CA . ? A CA 176 ? 1_555 OD1 ? A ASP 81 ? A ASP 80 ? 51_555 172.6 ? 2 OD1 ? A ASP 81 ? A ASP 80 ? 22_555 CA ? B CA . ? A CA 176 ? 1_555 OD2 ? A ASP 81 ? A ASP 80 ? 22_555 49.0 ? 3 OD1 ? A ASP 81 ? A ASP 80 ? 51_555 CA ? B CA . ? A CA 176 ? 1_555 OD2 ? A ASP 81 ? A ASP 80 ? 22_555 123.7 ? 4 OD1 ? A ASP 81 ? A ASP 80 ? 22_555 CA ? B CA . ? A CA 176 ? 1_555 OD2 ? A ASP 81 ? A ASP 80 ? 51_555 123.7 ? 5 OD1 ? A ASP 81 ? A ASP 80 ? 51_555 CA ? B CA . ? A CA 176 ? 1_555 OD2 ? A ASP 81 ? A ASP 80 ? 51_555 49.0 ? 6 OD2 ? A ASP 81 ? A ASP 80 ? 22_555 CA ? B CA . ? A CA 176 ? 1_555 OD2 ? A ASP 81 ? A ASP 80 ? 51_555 78.6 ? 7 OD1 ? A ASP 81 ? A ASP 80 ? 22_555 CA ? B CA . ? A CA 176 ? 1_555 NE2 ? A GLN 83 ? A GLN 82 ? 1_555 74.8 ? 8 OD1 ? A ASP 81 ? A ASP 80 ? 51_555 CA ? B CA . ? A CA 176 ? 1_555 NE2 ? A GLN 83 ? A GLN 82 ? 1_555 104.0 ? 9 OD2 ? A ASP 81 ? A ASP 80 ? 22_555 CA ? B CA . ? A CA 176 ? 1_555 NE2 ? A GLN 83 ? A GLN 82 ? 1_555 84.1 ? 10 OD2 ? A ASP 81 ? A ASP 80 ? 51_555 CA ? B CA . ? A CA 176 ? 1_555 NE2 ? A GLN 83 ? A GLN 82 ? 1_555 81.8 ? 11 OD1 ? A ASP 81 ? A ASP 80 ? 22_555 CA ? B CA . ? A CA 176 ? 1_555 NE2 ? A GLN 83 ? A GLN 82 ? 72_555 104.0 ? 12 OD1 ? A ASP 81 ? A ASP 80 ? 51_555 CA ? B CA . ? A CA 176 ? 1_555 NE2 ? A GLN 83 ? A GLN 82 ? 72_555 74.8 ? 13 OD2 ? A ASP 81 ? A ASP 80 ? 22_555 CA ? B CA . ? A CA 176 ? 1_555 NE2 ? A GLN 83 ? A GLN 82 ? 72_555 81.8 ? 14 OD2 ? A ASP 81 ? A ASP 80 ? 51_555 CA ? B CA . ? A CA 176 ? 1_555 NE2 ? A GLN 83 ? A GLN 82 ? 72_555 84.1 ? 15 NE2 ? A GLN 83 ? A GLN 82 ? 1_555 CA ? B CA . ? A CA 176 ? 1_555 NE2 ? A GLN 83 ? A GLN 82 ? 72_555 161.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-01-13 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2011-11-16 5 'Structure model' 1 4 2021-11-03 6 'Structure model' 1 5 2023-08-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Atomic model' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' Other 8 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' database_2 2 5 'Structure model' pdbx_database_status 3 5 'Structure model' pdbx_struct_conn_angle 4 5 'Structure model' struct_conn 5 5 'Structure model' struct_ref_seq_dif 6 5 'Structure model' struct_site 7 6 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_database_status.process_site' 4 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 16 5 'Structure model' '_pdbx_struct_conn_angle.value' 17 5 'Structure model' '_struct_conn.pdbx_dist_value' 18 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 21 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 5 'Structure model' '_struct_conn.ptnr1_symmetry' 25 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 26 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 29 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 30 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 31 5 'Structure model' '_struct_conn.ptnr2_symmetry' 32 5 'Structure model' '_struct_ref_seq_dif.details' 33 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 34 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 35 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.8 ? 1 X-PLOR refinement 3.8 ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 X-PLOR phasing 3.8 ? 5 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 NE2 A HIS 9 ? ? CD2 A HIS 9 ? ? 1.306 1.373 -0.067 0.011 N 2 1 NE2 A HIS 61 ? ? CD2 A HIS 61 ? ? 1.305 1.373 -0.068 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 86 ? ? CZ A ARG 86 ? ? NH2 A ARG 86 ? ? 117.13 120.30 -3.17 0.50 N 2 1 CD1 A TRP 89 ? ? CG A TRP 89 ? ? CD2 A TRP 89 ? ? 112.38 106.30 6.08 0.80 N 3 1 CE2 A TRP 89 ? ? CD2 A TRP 89 ? ? CG A TRP 89 ? ? 100.98 107.30 -6.32 0.80 N 4 1 NE A ARG 153 ? ? CZ A ARG 153 ? ? NH1 A ARG 153 ? ? 126.31 120.30 6.01 0.50 N 5 1 NE A ARG 153 ? ? CZ A ARG 153 ? ? NH2 A ARG 153 ? ? 112.88 120.30 -7.42 0.50 N 6 1 CG A MET 171 ? ? SD A MET 171 ? ? CE A MET 171 ? ? 87.31 100.20 -12.89 1.60 N # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 10 ? CG ? A ARG 11 CG 2 1 Y 1 A ARG 10 ? CD ? A ARG 11 CD 3 1 Y 1 A ARG 10 ? NE ? A ARG 11 NE 4 1 Y 1 A ARG 10 ? CZ ? A ARG 11 CZ 5 1 Y 1 A ARG 10 ? NH1 ? A ARG 11 NH1 6 1 Y 1 A ARG 10 ? NH2 ? A ARG 11 NH2 7 1 Y 1 A GLU 53 ? CD ? A GLU 54 CD 8 1 Y 1 A GLU 53 ? OE1 ? A GLU 54 OE1 9 1 Y 1 A GLU 53 ? OE2 ? A GLU 54 OE2 10 1 Y 1 A LYS 64 ? CG ? A LYS 65 CG 11 1 Y 1 A LYS 64 ? CD ? A LYS 65 CD 12 1 Y 1 A LYS 64 ? CE ? A LYS 65 CE 13 1 Y 1 A LYS 64 ? NZ ? A LYS 65 NZ 14 1 Y 1 A GLU 135 ? CG ? A GLU 136 CG 15 1 Y 1 A GLU 135 ? CD ? A GLU 136 CD 16 1 Y 1 A GLU 135 ? OE1 ? A GLU 136 OE1 17 1 Y 1 A GLU 135 ? OE2 ? A GLU 136 OE2 18 1 Y 1 A GLU 173 ? CG ? A GLU 174 CG 19 1 Y 1 A GLU 173 ? CD ? A GLU 174 CD 20 1 Y 1 A GLU 173 ? OE1 ? A GLU 174 OE1 21 1 Y 1 A GLU 173 ? OE2 ? A GLU 174 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A HIS 114 ? A HIS 115 3 1 Y 1 A LYS 115 ? A LYS 116 4 1 Y 1 A VAL 116 ? A VAL 117 5 1 Y 1 A GLY 117 ? A GLY 118 6 1 Y 1 A SER 118 ? A SER 119 7 1 Y 1 A ASP 119 ? A ASP 120 8 1 Y 1 A LYS 120 ? A LYS 121 9 1 Y 1 A VAL 121 ? A VAL 122 10 1 Y 1 A ASP 122 ? A ASP 123 11 1 Y 1 A PRO 123 ? A PRO 124 12 1 Y 1 A HIS 124 ? A HIS 125 13 1 Y 1 A LEU 125 ? A LEU 126 14 1 Y 1 A CYS 126 ? A CYS 127 15 1 Y 1 A ASP 127 ? A ASP 128 16 1 Y 1 A PHE 128 ? A PHE 129 17 1 Y 1 A LEU 129 ? A LEU 130 18 1 Y 1 A GLU 130 ? A GLU 131 19 1 Y 1 A THR 131 ? A THR 132 20 1 Y 1 A GLU 132 ? A GLU 133 21 1 Y 1 A TYR 133 ? A TYR 134 22 1 Y 1 A SER 174 ? A SER 175 23 1 Y 1 A SER 175 ? A SER 176 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1FHA _pdbx_initial_refinement_model.details ? #