data_1C8W # _entry.id 1C8W # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.291 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1C8W RCSB RCSB009438 WWPDB D_1000009438 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1C8W _pdbx_database_status.recvd_initial_deposition_date 1999-07-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kelemen, B.R.' 1 'Sweeney, R.T.' 2 'Schultz, L.W.' 3 'Raines, R.T.' 4 # _citation.id primary _citation.title 'Excavating an active site: the nucleobase specificity of ribonuclease A.' _citation.journal_abbrev Biochemistry _citation.journal_volume 39 _citation.page_first 14487 _citation.page_last 14494 _citation.year 2000 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11087402 _citation.pdbx_database_id_DOI 10.1021/bi001862f # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kelemen, B.R.' 1 primary 'Schultz, L.W.' 2 primary 'Sweeney, R.Y.' 3 primary 'Raines, R.T.' 4 # _cell.entry_id 1C8W _cell.length_a 64.32 _cell.length_b 64.32 _cell.length_c 64.84 _cell.angle_alpha 90.0 _cell.angle_beta 90.0 _cell.angle_gamma 120.0 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1C8W _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PROTEIN (Ribonuclease A)' 13664.273 1 ? T45G 'RNASE A' ? 2 non-polymer syn 'ACETATE ION' 59.044 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 3 ? ? ? ? 4 water nat water 18.015 115 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNGFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMS ITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV ; _entity_poly.pdbx_seq_one_letter_code_can ;KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNGFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMS ITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 GLU n 1 3 THR n 1 4 ALA n 1 5 ALA n 1 6 ALA n 1 7 LYS n 1 8 PHE n 1 9 GLU n 1 10 ARG n 1 11 GLN n 1 12 HIS n 1 13 MET n 1 14 ASP n 1 15 SER n 1 16 SER n 1 17 THR n 1 18 SER n 1 19 ALA n 1 20 ALA n 1 21 SER n 1 22 SER n 1 23 SER n 1 24 ASN n 1 25 TYR n 1 26 CYS n 1 27 ASN n 1 28 GLN n 1 29 MET n 1 30 MET n 1 31 LYS n 1 32 SER n 1 33 ARG n 1 34 ASN n 1 35 LEU n 1 36 THR n 1 37 LYS n 1 38 ASP n 1 39 ARG n 1 40 CYS n 1 41 LYS n 1 42 PRO n 1 43 VAL n 1 44 ASN n 1 45 GLY n 1 46 PHE n 1 47 VAL n 1 48 HIS n 1 49 GLU n 1 50 SER n 1 51 LEU n 1 52 ALA n 1 53 ASP n 1 54 VAL n 1 55 GLN n 1 56 ALA n 1 57 VAL n 1 58 CYS n 1 59 SER n 1 60 GLN n 1 61 LYS n 1 62 ASN n 1 63 VAL n 1 64 ALA n 1 65 CYS n 1 66 LYS n 1 67 ASN n 1 68 GLY n 1 69 GLN n 1 70 THR n 1 71 ASN n 1 72 CYS n 1 73 TYR n 1 74 GLN n 1 75 SER n 1 76 TYR n 1 77 SER n 1 78 THR n 1 79 MET n 1 80 SER n 1 81 ILE n 1 82 THR n 1 83 ASP n 1 84 CYS n 1 85 ARG n 1 86 GLU n 1 87 THR n 1 88 GLY n 1 89 SER n 1 90 SER n 1 91 LYS n 1 92 TYR n 1 93 PRO n 1 94 ASN n 1 95 CYS n 1 96 ALA n 1 97 TYR n 1 98 LYS n 1 99 THR n 1 100 THR n 1 101 GLN n 1 102 ALA n 1 103 ASN n 1 104 LYS n 1 105 HIS n 1 106 ILE n 1 107 ILE n 1 108 VAL n 1 109 ALA n 1 110 CYS n 1 111 GLU n 1 112 GLY n 1 113 ASN n 1 114 PRO n 1 115 TYR n 1 116 VAL n 1 117 PRO n 1 118 VAL n 1 119 HIS n 1 120 PHE n 1 121 ASP n 1 122 ALA n 1 123 SER n 1 124 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name cattle _entity_src_gen.gene_src_genus Bos _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ pancreas _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET22b+ _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RNAS1_BOVIN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P61823 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1C8W _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P61823 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 125 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 124 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1C8W _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 45 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P61823 _struct_ref_seq_dif.db_mon_id THR _struct_ref_seq_dif.pdbx_seq_db_seq_num 46 _struct_ref_seq_dif.details 'ENGINEERED MUTATION' _struct_ref_seq_dif.pdbx_auth_seq_num 45 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1C8W _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.83 _exptl_crystal.density_percent_sol 56.58 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.pdbx_details 'Ammonium sulfate, sodium chloride, sodium acetate, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 275 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'AREA DETECTOR' _diffrn_detector.type 'SIEMENS HI-STAR' _diffrn_detector.pdbx_collection_date 1995-10-08 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1C8W _reflns.observed_criterion_sigma_I 0.33 _reflns.observed_criterion_sigma_F 0.33 _reflns.d_resolution_low 30.0 _reflns.d_resolution_high 1.8 _reflns.number_obs 18761 _reflns.number_all 18836 _reflns.percent_possible_obs 96.0 _reflns.pdbx_Rmerge_I_obs 0.036 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 23.2 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.3 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.8 _reflns_shell.d_res_low 1.9 _reflns_shell.percent_possible_all 87.0 _reflns_shell.Rmerge_I_obs 0.19 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 1.9 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 18761 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1C8W _refine.ls_number_reflns_obs 18761 _refine.ls_number_reflns_all 19542 _refine.pdbx_ls_sigma_I 0.33 _refine.pdbx_ls_sigma_F 0.33 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 30.0 _refine.ls_d_res_high 1.8 _refine.ls_percent_reflns_obs 96 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.176 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol 0.90215 _refine.solvent_model_param_bsol 265.250 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 968 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.number_atoms_solvent 115 _refine_hist.number_atoms_total 1090 _refine_hist.d_res_high 1.8 _refine_hist.d_res_low 30.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function t_bond_d 0.011 ? 7.000 1001 'X-RAY DIFFRACTION' ? t_angle_deg 2.43 ? 10.000 1358 'X-RAY DIFFRACTION' ? t_dihedral_angle_d 18.150 ? 0.00 616 'X-RAY DIFFRACTION' ? t_trig_c_planes 0.007 ? 25.000 29 'X-RAY DIFFRACTION' ? t_gen_planes 0.012 ? 50.00 148 'X-RAY DIFFRACTION' ? t_nbd 0.073 ? 50.00 18 'X-RAY DIFFRACTION' ? t_incorr_chiral_ct 0 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1C8W _struct.title 'THR45GLY VARIANT OF RIBONUCLEASE A' _struct.pdbx_descriptor 'PROTEIN (124-MER)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1C8W _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'ANTI-PARALLEL BETA SHEET, RNASE A, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 3 ? MET A 13 ? THR A 3 MET A 13 1 ? 11 HELX_P HELX_P2 2 ASN A 24 ? ARG A 33 ? ASN A 24 ARG A 33 1 ? 10 HELX_P HELX_P3 3 SER A 50 ? ALA A 56 ? SER A 50 ALA A 56 1 ? 7 HELX_P HELX_P4 4 VAL A 57 ? GLN A 60 ? VAL A 57 GLN A 60 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 84 SG ? ? A CYS 26 A CYS 84 1_555 ? ? ? ? ? ? ? 2.039 ? disulf2 disulf ? ? A CYS 40 SG ? ? ? 1_555 A CYS 95 SG ? ? A CYS 40 A CYS 95 1_555 ? ? ? ? ? ? ? 1.990 ? disulf3 disulf ? ? A CYS 58 SG ? ? ? 1_555 A CYS 110 SG ? ? A CYS 58 A CYS 110 1_555 ? ? ? ? ? ? ? 1.978 ? disulf4 disulf ? ? A CYS 65 SG ? ? ? 1_555 A CYS 72 SG ? ? A CYS 65 A CYS 72 1_555 ? ? ? ? ? ? ? 2.005 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 92 A . ? TYR 92 A PRO 93 A ? PRO 93 A 1 4.88 2 ASN 113 A . ? ASN 113 A PRO 114 A ? PRO 114 A 1 2.94 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? A1 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A1 1 2 ? anti-parallel A1 2 3 ? anti-parallel A1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 116 ? VAL A 124 ? VAL A 116 VAL A 124 A 2 TYR A 97 ? GLU A 111 ? TYR A 97 GLU A 111 A 3 CYS A 72 ? GLN A 74 ? CYS A 72 GLN A 74 A 4 LYS A 61 ? VAL A 63 ? LYS A 61 VAL A 63 A1 1 VAL A 116 ? VAL A 124 ? VAL A 116 VAL A 124 A1 2 TYR A 97 ? GLU A 111 ? TYR A 97 GLU A 111 A1 3 MET A 79 ? GLU A 86 ? MET A 79 GLU A 86 A1 4 VAL A 43 ? VAL A 47 ? VAL A 43 VAL A 47 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 124 ? O VAL A 124 N HIS A 105 ? N HIS A 105 A 2 3 N VAL A 108 ? N VAL A 108 O TYR A 73 ? O TYR A 73 A 3 4 N GLN A 74 ? N GLN A 74 O LYS A 61 ? O LYS A 61 A1 1 2 O VAL A 124 ? O VAL A 124 N HIS A 105 ? N HIS A 105 A1 2 3 O LYS A 104 ? O LYS A 104 N MET A 79 ? N MET A 79 A1 3 4 O CYS A 84 ? O CYS A 84 N ASN A 44 ? N ASN A 44 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ACT A 155' AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 125' AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 126' AC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL A 127' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 12 ? HIS A 12 . ? 1_555 ? 2 AC1 4 HIS A 119 ? HIS A 119 . ? 1_555 ? 3 AC1 4 PHE A 120 ? PHE A 120 . ? 1_555 ? 4 AC1 4 HOH F . ? HOH A 166 . ? 1_555 ? 5 AC2 3 ARG A 10 ? ARG A 10 . ? 1_555 ? 6 AC2 3 ASN A 34 ? ASN A 34 . ? 1_555 ? 7 AC2 3 THR A 78 ? THR A 78 . ? 2_654 ? 8 AC3 3 HIS A 12 ? HIS A 12 . ? 1_555 ? 9 AC3 3 GLY A 45 ? GLY A 45 . ? 1_555 ? 10 AC3 3 HOH F . ? HOH A 173 . ? 1_555 ? 11 AC4 1 THR A 3 ? THR A 3 . ? 1_555 ? # _database_PDB_matrix.entry_id 1C8W _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1C8W _atom_sites.fract_transf_matrix[1][1] 0.015547 _atom_sites.fract_transf_matrix[1][2] 0.008976 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017952 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015423 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 CYS 84 84 84 CYS CYS A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 HIS 105 105 105 HIS HIS A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 CYS 110 110 110 CYS CYS A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 VAL 124 124 124 VAL VAL A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ACT 1 155 155 ACT OAC A . C 3 CL 1 125 125 CL CL- A . D 3 CL 1 126 126 CL CL- A . E 3 CL 1 127 127 CL CL- A . F 4 HOH 1 128 128 HOH WAT A . F 4 HOH 2 129 129 HOH WAT A . F 4 HOH 3 130 130 HOH WAT A . F 4 HOH 4 131 131 HOH WAT A . F 4 HOH 5 132 132 HOH WAT A . F 4 HOH 6 133 133 HOH WAT A . F 4 HOH 7 134 134 HOH WAT A . F 4 HOH 8 135 135 HOH WAT A . F 4 HOH 9 136 136 HOH WAT A . F 4 HOH 10 137 137 HOH WAT A . F 4 HOH 11 138 138 HOH WAT A . F 4 HOH 12 139 139 HOH WAT A . F 4 HOH 13 140 140 HOH WAT A . F 4 HOH 14 141 141 HOH WAT A . F 4 HOH 15 142 142 HOH WAT A . F 4 HOH 16 143 143 HOH WAT A . F 4 HOH 17 144 144 HOH WAT A . F 4 HOH 18 145 145 HOH WAT A . F 4 HOH 19 146 146 HOH WAT A . F 4 HOH 20 147 147 HOH WAT A . F 4 HOH 21 148 148 HOH WAT A . F 4 HOH 22 149 149 HOH WAT A . F 4 HOH 23 150 150 HOH WAT A . F 4 HOH 24 151 151 HOH WAT A . F 4 HOH 25 152 152 HOH WAT A . F 4 HOH 26 153 153 HOH WAT A . F 4 HOH 27 154 154 HOH WAT A . F 4 HOH 28 156 156 HOH WAT A . F 4 HOH 29 157 157 HOH WAT A . F 4 HOH 30 158 158 HOH WAT A . F 4 HOH 31 159 159 HOH WAT A . F 4 HOH 32 160 160 HOH WAT A . F 4 HOH 33 161 161 HOH WAT A . F 4 HOH 34 162 162 HOH WAT A . F 4 HOH 35 163 163 HOH WAT A . F 4 HOH 36 164 164 HOH WAT A . F 4 HOH 37 165 165 HOH WAT A . F 4 HOH 38 166 166 HOH WAT A . F 4 HOH 39 167 167 HOH WAT A . F 4 HOH 40 168 168 HOH WAT A . F 4 HOH 41 169 169 HOH WAT A . F 4 HOH 42 170 170 HOH WAT A . F 4 HOH 43 171 171 HOH WAT A . F 4 HOH 44 172 172 HOH WAT A . F 4 HOH 45 173 173 HOH WAT A . F 4 HOH 46 174 174 HOH WAT A . F 4 HOH 47 175 175 HOH WAT A . F 4 HOH 48 176 176 HOH WAT A . F 4 HOH 49 177 177 HOH WAT A . F 4 HOH 50 178 178 HOH WAT A . F 4 HOH 51 179 179 HOH WAT A . F 4 HOH 52 180 180 HOH WAT A . F 4 HOH 53 181 181 HOH WAT A . F 4 HOH 54 182 182 HOH WAT A . F 4 HOH 55 183 183 HOH WAT A . F 4 HOH 56 184 184 HOH WAT A . F 4 HOH 57 185 185 HOH WAT A . F 4 HOH 58 186 186 HOH WAT A . F 4 HOH 59 188 188 HOH WAT A . F 4 HOH 60 189 189 HOH WAT A . F 4 HOH 61 190 190 HOH WAT A . F 4 HOH 62 191 191 HOH WAT A . F 4 HOH 63 192 192 HOH WAT A . F 4 HOH 64 193 193 HOH WAT A . F 4 HOH 65 194 194 HOH WAT A . F 4 HOH 66 195 195 HOH WAT A . F 4 HOH 67 196 196 HOH WAT A . F 4 HOH 68 197 197 HOH WAT A . F 4 HOH 69 198 198 HOH WAT A . F 4 HOH 70 199 199 HOH WAT A . F 4 HOH 71 200 200 HOH WAT A . F 4 HOH 72 201 201 HOH WAT A . F 4 HOH 73 202 202 HOH WAT A . F 4 HOH 74 203 203 HOH WAT A . F 4 HOH 75 204 204 HOH WAT A . F 4 HOH 76 205 205 HOH WAT A . F 4 HOH 77 206 206 HOH WAT A . F 4 HOH 78 207 207 HOH WAT A . F 4 HOH 79 208 208 HOH WAT A . F 4 HOH 80 209 209 HOH WAT A . F 4 HOH 81 210 210 HOH WAT A . F 4 HOH 82 211 211 HOH WAT A . F 4 HOH 83 212 212 HOH WAT A . F 4 HOH 84 213 213 HOH WAT A . F 4 HOH 85 214 214 HOH WAT A . F 4 HOH 86 215 215 HOH WAT A . F 4 HOH 87 216 216 HOH WAT A . F 4 HOH 88 217 217 HOH WAT A . F 4 HOH 89 218 218 HOH WAT A . F 4 HOH 90 219 219 HOH WAT A . F 4 HOH 91 220 220 HOH WAT A . F 4 HOH 92 221 221 HOH WAT A . F 4 HOH 93 222 222 HOH WAT A . F 4 HOH 94 223 223 HOH WAT A . F 4 HOH 95 224 224 HOH WAT A . F 4 HOH 96 225 225 HOH WAT A . F 4 HOH 97 226 226 HOH WAT A . F 4 HOH 98 227 227 HOH WAT A . F 4 HOH 99 228 228 HOH WAT A . F 4 HOH 100 229 229 HOH WAT A . F 4 HOH 101 230 230 HOH WAT A . F 4 HOH 102 231 231 HOH WAT A . F 4 HOH 103 232 232 HOH WAT A . F 4 HOH 104 233 233 HOH WAT A . F 4 HOH 105 234 234 HOH WAT A . F 4 HOH 106 235 235 HOH WAT A . F 4 HOH 107 236 236 HOH WAT A . F 4 HOH 108 237 237 HOH WAT A . F 4 HOH 109 238 238 HOH WAT A . F 4 HOH 110 240 240 HOH WAT A . F 4 HOH 111 241 241 HOH WAT A . F 4 HOH 112 242 242 HOH WAT A . F 4 HOH 113 243 243 HOH WAT A . F 4 HOH 114 245 245 HOH WAT A . F 4 HOH 115 246 246 HOH WAT A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 233 ? F HOH . 2 1 A HOH 245 ? F HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-05-01 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-04 5 'Structure model' 1 4 2018-03-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Refinement description' 4 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' struct_ref_seq_dif # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 5 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal FRAMBO 'data collection' . ? 1 XDS 'data reduction' . ? 2 TNT refinement . ? 3 XDS 'data scaling' . ? 4 TNT phasing . ? 5 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 N A PHE 120 ? ? CA A PHE 120 ? B 1.608 1.459 0.149 0.020 N 2 1 CA A ASP 121 ? B CB A ASP 121 ? ? 1.717 1.535 0.182 0.022 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 14 ? ? CG A ASP 14 ? ? OD1 A ASP 14 ? ? 123.85 118.30 5.55 0.90 N 2 1 CB A ASP 14 ? ? CG A ASP 14 ? ? OD2 A ASP 14 ? ? 111.33 118.30 -6.97 0.90 N 3 1 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH1 A ARG 33 ? ? 124.19 120.30 3.89 0.50 N 4 1 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH2 A ARG 33 ? ? 117.06 120.30 -3.24 0.50 N 5 1 CB A ASP 53 ? ? CG A ASP 53 ? ? OD1 A ASP 53 ? ? 124.60 118.30 6.30 0.90 N 6 1 CB A ASP 53 ? ? CG A ASP 53 ? ? OD2 A ASP 53 ? ? 112.59 118.30 -5.71 0.90 N 7 1 CB A ASP 83 ? B CG A ASP 83 ? B OD1 A ASP 83 ? B 124.56 118.30 6.26 0.90 N 8 1 CB A PHE 120 ? ? CA A PHE 120 ? B C A PHE 120 ? B 76.10 110.40 -34.30 2.00 N 9 1 N A PHE 120 ? ? CA A PHE 120 ? B CB A PHE 120 ? ? 96.87 110.60 -13.73 1.80 N 10 1 CA A PHE 120 ? B CB A PHE 120 ? ? CG A PHE 120 ? ? 98.47 113.90 -15.43 2.40 N 11 1 CB A ASP 121 ? ? CA A ASP 121 ? B C A ASP 121 ? ? 98.18 110.40 -12.22 2.00 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 48 ? ? -99.22 58.99 2 1 GLN A 60 ? ? -97.33 -139.35 3 1 SER A 89 ? ? -66.28 -74.13 4 1 SER A 90 ? ? -3.03 120.72 5 1 ASN A 94 ? ? -103.73 70.14 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ACETATE ION' ACT 3 'CHLORIDE ION' CL 4 water HOH #