data_1D1O # _entry.id 1D1O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1D1O pdb_00001d1o 10.2210/pdb1d1o/pdb RCSB RCSB009713 ? ? WWPDB D_1000009713 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-03-08 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1D1O _pdbx_database_status.recvd_initial_deposition_date 1999-09-20 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2BCB 'NMR SOLUTION STRUCTURE OF CA2+-LOADED CALBINDIN D9K' unspecified PDB 1CDN 'NMR SOLUTION STRUCTURE OF (CD2+)1 CALBINDIN D9K' unspecified PDB 1CLB 'NMR SOLUTION STRUCTURE OF APO CALBINDIN D9K' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Maler, L.' 1 'Blankenship, J.' 2 'Rance, M.' 3 'Chazin, W.J.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Site-site communication in the EF-hand Ca2+-binding protein calbindin D9k.' Nat.Struct.Biol. 7 245 250 2000 NSBIEW US 1072-8368 2024 ? 10700285 10.1038/73369 1 ;Solution structure of (cd2+)1-calbindin D9k reveals details of the stepwise structural changes along the apo-(Ca2+)1-(Ca2+)2 binding pathway. ; J.Mol.Biol. 252 102 121 1995 JMOBAK UK 0022-2836 0070 ? ? 10.1006/jmbi.1995.0478 2 'High resolution solution structure of calcium-loaded calbindin D9k.' J.Mol.Biol. 231 711 734 1993 JMOBAK UK 0022-2836 0070 ? ? 10.1006/jmbi.1993.1322 3 'Determination of the solution structure of apo calbindin D9k by NMR spectroscopy.' J.Mol.Biol. 249 441 462 1995 JMOBAK UK 0022-2836 0070 ? ? 10.1006/jmbi.1995.0308 4 'Characterization of the N-terminal half-saturated state of calbindin D9k: NMR studies of the N56A mutant.' 'Protein Sci.' 4 1045 1055 1995 PRCIEI US 0961-8368 0795 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Maler, L.' 1 ? primary 'Blankenship, J.' 2 ? primary 'Rance, M.' 3 ? primary 'Chazin, W.J.' 4 ? 1 'Akke, M.' 5 ? 1 'Forsen, S.' 6 ? 1 'Chazin, W.J.' 7 ? 2 'Kordel, J.' 8 ? 2 'Skelton, N.J.' 9 ? 2 'Akke, M.' 10 ? 2 'Chazin, W.J.' 11 ? 3 'Skelton, N.J.' 12 ? 3 'Kordel, J.' 13 ? 3 'Chazin, W.J.' 14 ? 4 'Wimberly, B.' 15 ? 4 'Thulin, E.' 16 ? 4 'Chazin, W.J.' 17 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'CALBINDIN D9K' _entity.formula_weight 8501.611 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'P43M, N56A' _entity.pdbx_fragment 'CALBINDIN D9K' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKAGDGEVSFEEFQVLVKKISQ _entity_poly.pdbx_seq_one_letter_code_can KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGMSTLDELFEELDKAGDGEVSFEEFQVLVKKISQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 SER n 1 3 PRO n 1 4 GLU n 1 5 GLU n 1 6 LEU n 1 7 LYS n 1 8 GLY n 1 9 ILE n 1 10 PHE n 1 11 GLU n 1 12 LYS n 1 13 TYR n 1 14 ALA n 1 15 ALA n 1 16 LYS n 1 17 GLU n 1 18 GLY n 1 19 ASP n 1 20 PRO n 1 21 ASN n 1 22 GLN n 1 23 LEU n 1 24 SER n 1 25 LYS n 1 26 GLU n 1 27 GLU n 1 28 LEU n 1 29 LYS n 1 30 LEU n 1 31 LEU n 1 32 LEU n 1 33 GLN n 1 34 THR n 1 35 GLU n 1 36 PHE n 1 37 PRO n 1 38 SER n 1 39 LEU n 1 40 LEU n 1 41 LYS n 1 42 GLY n 1 43 MET n 1 44 SER n 1 45 THR n 1 46 LEU n 1 47 ASP n 1 48 GLU n 1 49 LEU n 1 50 PHE n 1 51 GLU n 1 52 GLU n 1 53 LEU n 1 54 ASP n 1 55 LYS n 1 56 ALA n 1 57 GLY n 1 58 ASP n 1 59 GLY n 1 60 GLU n 1 61 VAL n 1 62 SER n 1 63 PHE n 1 64 GLU n 1 65 GLU n 1 66 PHE n 1 67 GLN n 1 68 VAL n 1 69 LEU n 1 70 VAL n 1 71 LYS n 1 72 LYS n 1 73 ILE n 1 74 SER n 1 75 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name cattle _entity_src_gen.gene_src_genus Bos _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 GLN 75 75 75 GLN GLN A . n # _cell.entry_id 1D1O _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1D1O _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1D1O _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1D1O _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1D1O _struct.title ;COOPERATIVITY IN EF-HAND CA2+-BINDING PROTEINS: EVIDENCE OF SITE-SITE COMMUNICATION FROM BINDING-INDUCED CHANGES IN STRUCTURE AND DYNAMICS OF N56A CALBINDIN D9K ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1D1O _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'EF-HAND, CALCIUM-BINDING PROTEIN, SIGNAL TRANSDUCTION, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code S100G_BOVIN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P02633 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1D1O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 75 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02633 _struct_ref_seq.db_align_beg 5 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 79 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1D1O MET A 43 ? UNP P02633 PRO 47 conflict 43 1 1 1D1O ALA A 56 ? UNP P02633 ASN 60 conflict 56 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 1 ? GLU A 17 ? LYS A 1 GLU A 17 1 ? 17 HELX_P HELX_P2 2 LYS A 25 ? PHE A 36 ? LYS A 25 PHE A 36 1 ? 12 HELX_P HELX_P3 3 GLY A 42 ? SER A 44 ? GLY A 42 SER A 44 5 ? 3 HELX_P HELX_P4 4 THR A 45 ? ASP A 54 ? THR A 45 ASP A 54 1 ? 10 HELX_P HELX_P5 5 PHE A 63 ? SER A 74 ? PHE A 63 SER A 74 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 22 ? SER A 24 ? GLN A 22 SER A 24 A 2 GLU A 60 ? SER A 62 ? GLU A 60 SER A 62 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 23 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 23 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 61 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 61 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 37 ? ? -39.24 -36.24 2 1 LYS A 41 ? ? 62.98 -65.80 3 1 ASP A 54 ? ? -81.08 45.15 4 1 ASP A 58 ? ? 66.43 -57.67 5 1 SER A 74 ? ? 76.25 -44.16 6 2 PRO A 37 ? ? -69.69 71.72 7 2 SER A 38 ? ? -170.63 -73.55 8 2 LYS A 41 ? ? 49.02 -56.75 9 2 ASP A 58 ? ? 34.16 54.49 10 2 SER A 74 ? ? 78.23 -46.88 11 3 PRO A 37 ? ? -66.23 75.55 12 3 SER A 38 ? ? 173.59 -42.93 13 3 LEU A 40 ? ? -169.33 40.66 14 3 ASP A 54 ? ? -78.81 43.32 15 3 ALA A 56 ? ? 177.43 -54.06 16 3 ASP A 58 ? ? 68.64 -59.70 17 4 ASN A 21 ? ? -159.83 38.79 18 4 SER A 38 ? ? 75.18 -40.08 19 4 MET A 43 ? ? -87.61 -122.86 20 4 ASP A 54 ? ? -80.55 48.23 21 4 ASP A 58 ? ? 0.34 75.10 22 5 ASN A 21 ? ? -148.76 53.74 23 5 PRO A 37 ? ? -69.31 72.15 24 5 SER A 38 ? ? -178.84 -35.69 25 5 LEU A 40 ? ? -68.59 64.63 26 5 LYS A 41 ? ? -65.62 77.66 27 5 ASP A 54 ? ? -80.24 45.80 28 5 ALA A 56 ? ? -172.26 -55.00 29 6 ASN A 21 ? ? -143.59 42.08 30 6 PRO A 37 ? ? -22.04 79.83 31 6 LYS A 41 ? ? 68.06 -54.67 32 6 SER A 44 ? ? 64.68 -61.96 33 6 THR A 45 ? ? -37.05 -33.97 34 6 SER A 74 ? ? 69.55 -66.25 35 7 ASP A 19 ? ? -39.69 115.18 36 7 GLN A 22 ? ? -173.75 142.96 37 7 PHE A 36 ? ? -112.40 73.86 38 7 SER A 38 ? ? 66.79 -41.12 39 7 LEU A 40 ? ? -53.39 9.56 40 7 ASP A 54 ? ? -80.87 43.61 41 7 SER A 74 ? ? 73.06 -57.92 42 8 GLN A 22 ? ? -171.69 140.20 43 8 SER A 38 ? ? 70.98 -50.78 44 8 MET A 43 ? ? -67.12 -72.39 45 8 ALA A 56 ? ? 176.83 -36.94 46 8 SER A 74 ? ? 65.82 -57.70 47 9 ASN A 21 ? ? -144.47 38.56 48 9 SER A 38 ? ? -160.53 -68.48 49 9 LEU A 40 ? ? -179.04 -44.79 50 9 LYS A 41 ? ? 61.15 -68.31 51 9 MET A 43 ? ? -164.29 -150.85 52 9 ASP A 54 ? ? -80.17 48.75 53 9 ASP A 58 ? ? 34.83 56.49 54 10 PRO A 37 ? ? -66.45 74.71 55 10 SER A 38 ? ? -168.67 -60.34 56 10 LEU A 39 ? ? -79.77 49.44 57 10 LEU A 40 ? ? -165.83 3.51 58 10 ASP A 58 ? ? 31.59 56.48 59 10 SER A 74 ? ? 72.18 -48.71 60 11 SER A 38 ? ? -174.79 -65.40 61 11 LYS A 41 ? ? 51.45 -65.19 62 11 ASP A 54 ? ? -79.19 40.30 63 11 ALA A 56 ? ? 177.43 -49.91 64 11 ASP A 58 ? ? 66.13 -46.51 65 12 ASN A 21 ? ? -153.17 28.15 66 12 SER A 38 ? ? 69.53 -48.35 67 12 ASP A 54 ? ? -80.02 40.87 68 12 ASP A 58 ? ? 32.62 56.83 69 12 SER A 74 ? ? 71.83 -55.59 70 13 ASN A 21 ? ? -142.33 27.83 71 13 PRO A 37 ? ? -45.56 150.92 72 13 SER A 38 ? ? 69.85 -56.38 73 13 LYS A 41 ? ? -76.98 45.61 74 13 MET A 43 ? ? -59.21 103.13 75 13 SER A 44 ? ? 68.64 -54.21 76 13 THR A 45 ? ? -43.83 -18.37 77 13 ASP A 54 ? ? -80.37 47.53 78 13 ASP A 58 ? ? 36.39 54.12 79 13 SER A 74 ? ? 75.13 -37.61 80 14 SER A 38 ? ? 70.08 -42.90 81 14 LYS A 41 ? ? 67.40 -64.38 82 14 SER A 74 ? ? 73.58 -64.32 83 15 PRO A 37 ? ? -69.75 72.38 84 15 SER A 38 ? ? -177.05 -39.15 85 15 LYS A 41 ? ? -66.19 76.68 86 15 SER A 74 ? ? 74.09 -42.88 87 16 GLU A 17 ? ? -94.30 31.36 88 16 ASP A 19 ? ? -54.48 105.85 89 16 PRO A 20 ? ? -80.40 32.67 90 16 ASN A 21 ? ? -163.57 25.51 91 16 SER A 38 ? ? 70.44 -41.21 92 16 LYS A 41 ? ? 65.22 -69.15 93 16 MET A 43 ? ? 24.07 -97.33 94 16 SER A 74 ? ? 82.37 -50.06 95 17 PRO A 37 ? ? -66.47 75.17 96 17 SER A 38 ? ? 176.19 -42.20 97 17 LEU A 40 ? ? -166.47 18.13 98 17 ASP A 54 ? ? -80.35 49.82 99 17 ASP A 58 ? ? 67.84 -60.44 100 17 SER A 74 ? ? 75.59 -53.37 101 18 PRO A 37 ? ? -67.15 73.76 102 18 SER A 38 ? ? 176.92 -36.64 103 18 LEU A 40 ? ? -67.59 49.85 104 18 LYS A 41 ? ? -69.41 75.12 105 18 ASP A 58 ? ? 38.19 52.79 106 18 SER A 74 ? ? 75.54 -44.27 107 19 ASN A 21 ? ? -150.33 37.51 108 19 PRO A 37 ? ? -38.89 138.24 109 19 SER A 38 ? ? 68.87 -46.21 110 19 LEU A 40 ? ? -14.53 -76.72 111 19 MET A 43 ? ? 50.63 -138.70 112 19 ASP A 54 ? ? -80.33 44.88 113 19 ASP A 58 ? ? 69.29 -59.74 114 19 SER A 74 ? ? 74.81 -54.06 115 20 ASN A 21 ? ? -146.56 33.13 116 20 PRO A 37 ? ? -60.18 80.83 117 20 SER A 38 ? ? 177.91 -49.50 118 20 LEU A 40 ? ? -156.31 41.29 119 20 LYS A 41 ? ? -67.63 76.16 120 20 ASP A 58 ? ? 2.23 73.37 121 21 ASN A 21 ? ? -153.38 41.12 122 21 PRO A 37 ? ? -66.59 74.93 123 21 SER A 38 ? ? -178.29 -43.43 124 21 LEU A 40 ? ? -156.69 39.36 125 21 LYS A 41 ? ? -61.95 80.38 126 21 MET A 43 ? ? 61.35 -70.98 127 21 ALA A 56 ? ? 118.17 -140.74 128 21 ASP A 58 ? ? 67.07 65.79 129 21 SER A 74 ? ? 74.19 -49.44 130 22 GLU A 17 ? ? -159.30 81.20 131 22 PRO A 37 ? ? -64.97 83.11 132 22 SER A 38 ? ? 154.55 -28.81 133 22 LYS A 41 ? ? 66.83 -59.78 134 22 SER A 74 ? ? 85.16 -42.14 135 23 PRO A 20 ? ? -79.97 35.81 136 23 ASN A 21 ? ? -159.89 22.19 137 23 SER A 38 ? ? 73.50 -38.24 138 23 LEU A 40 ? ? 174.18 -12.06 139 23 LYS A 41 ? ? 70.44 -64.13 140 23 MET A 43 ? ? 26.46 -92.17 141 23 SER A 74 ? ? 72.55 -52.52 142 24 LYS A 16 ? ? -80.44 -85.54 143 24 ASP A 19 ? ? -178.75 147.23 144 24 PRO A 20 ? ? -24.60 -50.39 145 24 SER A 38 ? ? 70.07 -37.06 146 24 LYS A 41 ? ? 64.40 -64.22 147 24 ASP A 54 ? ? -80.64 46.35 148 24 ASP A 58 ? ? -2.39 76.86 149 24 SER A 74 ? ? 77.62 42.98 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 PHE A 10 ? ? 0.081 'SIDE CHAIN' 2 3 PHE A 10 ? ? 0.090 'SIDE CHAIN' 3 7 PHE A 10 ? ? 0.087 'SIDE CHAIN' 4 8 PHE A 10 ? ? 0.090 'SIDE CHAIN' 5 8 PHE A 36 ? ? 0.090 'SIDE CHAIN' 6 10 PHE A 36 ? ? 0.078 'SIDE CHAIN' 7 11 PHE A 10 ? ? 0.085 'SIDE CHAIN' 8 13 PHE A 36 ? ? 0.102 'SIDE CHAIN' 9 14 PHE A 10 ? ? 0.092 'SIDE CHAIN' 10 15 PHE A 10 ? ? 0.088 'SIDE CHAIN' 11 16 PHE A 36 ? ? 0.092 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1D1O _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 24 _pdbx_nmr_ensemble.conformer_selection_criteria ;STRUCTURES WITH ACCEPTABLE MOLECULAR ENEGIES WERE ORDERED BY LEAST RESTRAINT VIOLATIONS. THE 24 BEST CONFORMERS WERE SELECTED TO FACILITATE COMPARISON TO PREVIOUS STRUCTURES OF THE PROTEIN AND BECAUSE THIS SURPASSES THE STATISTICAL REQUIREMENT TO REPRESENT ALL OF CONFORMATIONAL SPACE CONSISTENT WITH THE DATA. ; _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1D1O _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '4 MM N56A-CALBINDIN D9K' ? 2 '4 MM 15N-LABELED N56A-CALBINDIN D9K;' ? # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 300 AMBIENT 6.0 0 ? K 2 300 AMBIENT 6.0 0 ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 1 2 2 3D_15N-SEPARATED_NOESY 2 3 2 HSQC-J 2 # _pdbx_nmr_details.entry_id 1D1O _pdbx_nmr_details.text ;1H RESONANCE ASIGNMENTS WERE REPORTED IN THE PROTEIN SCIENCE PAPER BY WIMBERLY ET AL. A 3D 15N SPARATED TOCSY WAS RECORDED TO CONFIRM THESE ASSIGNMENTS AND ASSIGN THE 15N RESONANCES. ; # _pdbx_nmr_refine.entry_id 1D1O _pdbx_nmr_refine.method 'DISTANCE GEOMETRY FOLLOWED BY SIMULATED ANNEALING' _pdbx_nmr_refine.details ;NMR REFINEMENT WAS BASED ON A TOTAL OF 910 NOE-DERIVED DISTANCE CONSTRAINTS AND 78 TORSION ANGLE CONSTRAINTS. SIMULATED ANNEALING CYCLE OF 20 PS HEATING TO 1200 K. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' Felix 97.0 'MSI, SAN DIEGO, CA' 1 'structure solution' DIANA 2.8 'GUNTERT, BRAUN, BILLETER, WUTHRICH' 2 refinement Amber 4.1 'PEARLMAN, CASE, CALDWELL, ROSS, CHEATHAM, FERGUSON, SEIBEL, SINGH, WEINER, KOLLMAN' 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLN N N N N 47 GLN CA C N S 48 GLN C C N N 49 GLN O O N N 50 GLN CB C N N 51 GLN CG C N N 52 GLN CD C N N 53 GLN OE1 O N N 54 GLN NE2 N N N 55 GLN OXT O N N 56 GLN H H N N 57 GLN H2 H N N 58 GLN HA H N N 59 GLN HB2 H N N 60 GLN HB3 H N N 61 GLN HG2 H N N 62 GLN HG3 H N N 63 GLN HE21 H N N 64 GLN HE22 H N N 65 GLN HXT H N N 66 GLU N N N N 67 GLU CA C N S 68 GLU C C N N 69 GLU O O N N 70 GLU CB C N N 71 GLU CG C N N 72 GLU CD C N N 73 GLU OE1 O N N 74 GLU OE2 O N N 75 GLU OXT O N N 76 GLU H H N N 77 GLU H2 H N N 78 GLU HA H N N 79 GLU HB2 H N N 80 GLU HB3 H N N 81 GLU HG2 H N N 82 GLU HG3 H N N 83 GLU HE2 H N N 84 GLU HXT H N N 85 GLY N N N N 86 GLY CA C N N 87 GLY C C N N 88 GLY O O N N 89 GLY OXT O N N 90 GLY H H N N 91 GLY H2 H N N 92 GLY HA2 H N N 93 GLY HA3 H N N 94 GLY HXT H N N 95 ILE N N N N 96 ILE CA C N S 97 ILE C C N N 98 ILE O O N N 99 ILE CB C N S 100 ILE CG1 C N N 101 ILE CG2 C N N 102 ILE CD1 C N N 103 ILE OXT O N N 104 ILE H H N N 105 ILE H2 H N N 106 ILE HA H N N 107 ILE HB H N N 108 ILE HG12 H N N 109 ILE HG13 H N N 110 ILE HG21 H N N 111 ILE HG22 H N N 112 ILE HG23 H N N 113 ILE HD11 H N N 114 ILE HD12 H N N 115 ILE HD13 H N N 116 ILE HXT H N N 117 LEU N N N N 118 LEU CA C N S 119 LEU C C N N 120 LEU O O N N 121 LEU CB C N N 122 LEU CG C N N 123 LEU CD1 C N N 124 LEU CD2 C N N 125 LEU OXT O N N 126 LEU H H N N 127 LEU H2 H N N 128 LEU HA H N N 129 LEU HB2 H N N 130 LEU HB3 H N N 131 LEU HG H N N 132 LEU HD11 H N N 133 LEU HD12 H N N 134 LEU HD13 H N N 135 LEU HD21 H N N 136 LEU HD22 H N N 137 LEU HD23 H N N 138 LEU HXT H N N 139 LYS N N N N 140 LYS CA C N S 141 LYS C C N N 142 LYS O O N N 143 LYS CB C N N 144 LYS CG C N N 145 LYS CD C N N 146 LYS CE C N N 147 LYS NZ N N N 148 LYS OXT O N N 149 LYS H H N N 150 LYS H2 H N N 151 LYS HA H N N 152 LYS HB2 H N N 153 LYS HB3 H N N 154 LYS HG2 H N N 155 LYS HG3 H N N 156 LYS HD2 H N N 157 LYS HD3 H N N 158 LYS HE2 H N N 159 LYS HE3 H N N 160 LYS HZ1 H N N 161 LYS HZ2 H N N 162 LYS HZ3 H N N 163 LYS HXT H N N 164 MET N N N N 165 MET CA C N S 166 MET C C N N 167 MET O O N N 168 MET CB C N N 169 MET CG C N N 170 MET SD S N N 171 MET CE C N N 172 MET OXT O N N 173 MET H H N N 174 MET H2 H N N 175 MET HA H N N 176 MET HB2 H N N 177 MET HB3 H N N 178 MET HG2 H N N 179 MET HG3 H N N 180 MET HE1 H N N 181 MET HE2 H N N 182 MET HE3 H N N 183 MET HXT H N N 184 PHE N N N N 185 PHE CA C N S 186 PHE C C N N 187 PHE O O N N 188 PHE CB C N N 189 PHE CG C Y N 190 PHE CD1 C Y N 191 PHE CD2 C Y N 192 PHE CE1 C Y N 193 PHE CE2 C Y N 194 PHE CZ C Y N 195 PHE OXT O N N 196 PHE H H N N 197 PHE H2 H N N 198 PHE HA H N N 199 PHE HB2 H N N 200 PHE HB3 H N N 201 PHE HD1 H N N 202 PHE HD2 H N N 203 PHE HE1 H N N 204 PHE HE2 H N N 205 PHE HZ H N N 206 PHE HXT H N N 207 PRO N N N N 208 PRO CA C N S 209 PRO C C N N 210 PRO O O N N 211 PRO CB C N N 212 PRO CG C N N 213 PRO CD C N N 214 PRO OXT O N N 215 PRO H H N N 216 PRO HA H N N 217 PRO HB2 H N N 218 PRO HB3 H N N 219 PRO HG2 H N N 220 PRO HG3 H N N 221 PRO HD2 H N N 222 PRO HD3 H N N 223 PRO HXT H N N 224 SER N N N N 225 SER CA C N S 226 SER C C N N 227 SER O O N N 228 SER CB C N N 229 SER OG O N N 230 SER OXT O N N 231 SER H H N N 232 SER H2 H N N 233 SER HA H N N 234 SER HB2 H N N 235 SER HB3 H N N 236 SER HG H N N 237 SER HXT H N N 238 THR N N N N 239 THR CA C N S 240 THR C C N N 241 THR O O N N 242 THR CB C N R 243 THR OG1 O N N 244 THR CG2 C N N 245 THR OXT O N N 246 THR H H N N 247 THR H2 H N N 248 THR HA H N N 249 THR HB H N N 250 THR HG1 H N N 251 THR HG21 H N N 252 THR HG22 H N N 253 THR HG23 H N N 254 THR HXT H N N 255 TYR N N N N 256 TYR CA C N S 257 TYR C C N N 258 TYR O O N N 259 TYR CB C N N 260 TYR CG C Y N 261 TYR CD1 C Y N 262 TYR CD2 C Y N 263 TYR CE1 C Y N 264 TYR CE2 C Y N 265 TYR CZ C Y N 266 TYR OH O N N 267 TYR OXT O N N 268 TYR H H N N 269 TYR H2 H N N 270 TYR HA H N N 271 TYR HB2 H N N 272 TYR HB3 H N N 273 TYR HD1 H N N 274 TYR HD2 H N N 275 TYR HE1 H N N 276 TYR HE2 H N N 277 TYR HH H N N 278 TYR HXT H N N 279 VAL N N N N 280 VAL CA C N S 281 VAL C C N N 282 VAL O O N N 283 VAL CB C N N 284 VAL CG1 C N N 285 VAL CG2 C N N 286 VAL OXT O N N 287 VAL H H N N 288 VAL H2 H N N 289 VAL HA H N N 290 VAL HB H N N 291 VAL HG11 H N N 292 VAL HG12 H N N 293 VAL HG13 H N N 294 VAL HG21 H N N 295 VAL HG22 H N N 296 VAL HG23 H N N 297 VAL HXT H N N 298 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 ILE N CA sing N N 90 ILE N H sing N N 91 ILE N H2 sing N N 92 ILE CA C sing N N 93 ILE CA CB sing N N 94 ILE CA HA sing N N 95 ILE C O doub N N 96 ILE C OXT sing N N 97 ILE CB CG1 sing N N 98 ILE CB CG2 sing N N 99 ILE CB HB sing N N 100 ILE CG1 CD1 sing N N 101 ILE CG1 HG12 sing N N 102 ILE CG1 HG13 sing N N 103 ILE CG2 HG21 sing N N 104 ILE CG2 HG22 sing N N 105 ILE CG2 HG23 sing N N 106 ILE CD1 HD11 sing N N 107 ILE CD1 HD12 sing N N 108 ILE CD1 HD13 sing N N 109 ILE OXT HXT sing N N 110 LEU N CA sing N N 111 LEU N H sing N N 112 LEU N H2 sing N N 113 LEU CA C sing N N 114 LEU CA CB sing N N 115 LEU CA HA sing N N 116 LEU C O doub N N 117 LEU C OXT sing N N 118 LEU CB CG sing N N 119 LEU CB HB2 sing N N 120 LEU CB HB3 sing N N 121 LEU CG CD1 sing N N 122 LEU CG CD2 sing N N 123 LEU CG HG sing N N 124 LEU CD1 HD11 sing N N 125 LEU CD1 HD12 sing N N 126 LEU CD1 HD13 sing N N 127 LEU CD2 HD21 sing N N 128 LEU CD2 HD22 sing N N 129 LEU CD2 HD23 sing N N 130 LEU OXT HXT sing N N 131 LYS N CA sing N N 132 LYS N H sing N N 133 LYS N H2 sing N N 134 LYS CA C sing N N 135 LYS CA CB sing N N 136 LYS CA HA sing N N 137 LYS C O doub N N 138 LYS C OXT sing N N 139 LYS CB CG sing N N 140 LYS CB HB2 sing N N 141 LYS CB HB3 sing N N 142 LYS CG CD sing N N 143 LYS CG HG2 sing N N 144 LYS CG HG3 sing N N 145 LYS CD CE sing N N 146 LYS CD HD2 sing N N 147 LYS CD HD3 sing N N 148 LYS CE NZ sing N N 149 LYS CE HE2 sing N N 150 LYS CE HE3 sing N N 151 LYS NZ HZ1 sing N N 152 LYS NZ HZ2 sing N N 153 LYS NZ HZ3 sing N N 154 LYS OXT HXT sing N N 155 MET N CA sing N N 156 MET N H sing N N 157 MET N H2 sing N N 158 MET CA C sing N N 159 MET CA CB sing N N 160 MET CA HA sing N N 161 MET C O doub N N 162 MET C OXT sing N N 163 MET CB CG sing N N 164 MET CB HB2 sing N N 165 MET CB HB3 sing N N 166 MET CG SD sing N N 167 MET CG HG2 sing N N 168 MET CG HG3 sing N N 169 MET SD CE sing N N 170 MET CE HE1 sing N N 171 MET CE HE2 sing N N 172 MET CE HE3 sing N N 173 MET OXT HXT sing N N 174 PHE N CA sing N N 175 PHE N H sing N N 176 PHE N H2 sing N N 177 PHE CA C sing N N 178 PHE CA CB sing N N 179 PHE CA HA sing N N 180 PHE C O doub N N 181 PHE C OXT sing N N 182 PHE CB CG sing N N 183 PHE CB HB2 sing N N 184 PHE CB HB3 sing N N 185 PHE CG CD1 doub Y N 186 PHE CG CD2 sing Y N 187 PHE CD1 CE1 sing Y N 188 PHE CD1 HD1 sing N N 189 PHE CD2 CE2 doub Y N 190 PHE CD2 HD2 sing N N 191 PHE CE1 CZ doub Y N 192 PHE CE1 HE1 sing N N 193 PHE CE2 CZ sing Y N 194 PHE CE2 HE2 sing N N 195 PHE CZ HZ sing N N 196 PHE OXT HXT sing N N 197 PRO N CA sing N N 198 PRO N CD sing N N 199 PRO N H sing N N 200 PRO CA C sing N N 201 PRO CA CB sing N N 202 PRO CA HA sing N N 203 PRO C O doub N N 204 PRO C OXT sing N N 205 PRO CB CG sing N N 206 PRO CB HB2 sing N N 207 PRO CB HB3 sing N N 208 PRO CG CD sing N N 209 PRO CG HG2 sing N N 210 PRO CG HG3 sing N N 211 PRO CD HD2 sing N N 212 PRO CD HD3 sing N N 213 PRO OXT HXT sing N N 214 SER N CA sing N N 215 SER N H sing N N 216 SER N H2 sing N N 217 SER CA C sing N N 218 SER CA CB sing N N 219 SER CA HA sing N N 220 SER C O doub N N 221 SER C OXT sing N N 222 SER CB OG sing N N 223 SER CB HB2 sing N N 224 SER CB HB3 sing N N 225 SER OG HG sing N N 226 SER OXT HXT sing N N 227 THR N CA sing N N 228 THR N H sing N N 229 THR N H2 sing N N 230 THR CA C sing N N 231 THR CA CB sing N N 232 THR CA HA sing N N 233 THR C O doub N N 234 THR C OXT sing N N 235 THR CB OG1 sing N N 236 THR CB CG2 sing N N 237 THR CB HB sing N N 238 THR OG1 HG1 sing N N 239 THR CG2 HG21 sing N N 240 THR CG2 HG22 sing N N 241 THR CG2 HG23 sing N N 242 THR OXT HXT sing N N 243 TYR N CA sing N N 244 TYR N H sing N N 245 TYR N H2 sing N N 246 TYR CA C sing N N 247 TYR CA CB sing N N 248 TYR CA HA sing N N 249 TYR C O doub N N 250 TYR C OXT sing N N 251 TYR CB CG sing N N 252 TYR CB HB2 sing N N 253 TYR CB HB3 sing N N 254 TYR CG CD1 doub Y N 255 TYR CG CD2 sing Y N 256 TYR CD1 CE1 sing Y N 257 TYR CD1 HD1 sing N N 258 TYR CD2 CE2 doub Y N 259 TYR CD2 HD2 sing N N 260 TYR CE1 CZ doub Y N 261 TYR CE1 HE1 sing N N 262 TYR CE2 CZ sing Y N 263 TYR CE2 HE2 sing N N 264 TYR CZ OH sing N N 265 TYR OH HH sing N N 266 TYR OXT HXT sing N N 267 VAL N CA sing N N 268 VAL N H sing N N 269 VAL N H2 sing N N 270 VAL CA C sing N N 271 VAL CA CB sing N N 272 VAL CA HA sing N N 273 VAL C O doub N N 274 VAL C OXT sing N N 275 VAL CB CG1 sing N N 276 VAL CB CG2 sing N N 277 VAL CB HB sing N N 278 VAL CG1 HG11 sing N N 279 VAL CG1 HG12 sing N N 280 VAL CG1 HG13 sing N N 281 VAL CG2 HG21 sing N N 282 VAL CG2 HG22 sing N N 283 VAL CG2 HG23 sing N N 284 VAL OXT HXT sing N N 285 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AMX Bruker 500 ? 2 DRX Bruker 600 ? 3 INOVA Varian 600 ? # _atom_sites.entry_id 1D1O _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_