data_1DGU # _entry.id 1DGU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1DGU pdb_00001dgu 10.2210/pdb1dgu/pdb RCSB RCSB010077 ? ? WWPDB D_1000010077 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1DGV _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1DGU _pdbx_database_status.recvd_initial_deposition_date 1999-11-25 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hwang, P.M.' 1 'Vogel, H.J.' 2 # _citation.id primary _citation.title ;Structures of the platelet calcium- and integrin-binding protein and the alphaIIb-integrin cytoplasmic domain suggest a mechanism for calcium-regulated recognition; homology modelling and NMR studies. ; _citation.journal_abbrev J.Mol.Recog. _citation.journal_volume 13 _citation.page_first 83 _citation.page_last 92 _citation.year 2000 _citation.journal_id_ASTM JMORE4 _citation.country UK _citation.journal_id_ISSN 0952-3499 _citation.journal_id_CSD 0814 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10822252 _citation.pdbx_database_id_DOI '10.1002/(SICI)1099-1352(200003/04)13:2<83::AID-JMR491>3.3.CO;2-1' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hwang, P.M.' 1 ? primary 'Vogel, H.J.' 2 ? # _cell.entry_id 1DGU _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1DGU _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'CALCIUM-SATURATED CIB' _entity.formula_weight 20980.490 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSF EDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTI NLSEFQHVISRSPDFASSFKIVL ; _entity_poly.pdbx_seq_one_letter_code_can ;SKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSF EDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTI NLSEFQHVISRSPDFASSFKIVL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LYS n 1 3 GLU n 1 4 LEU n 1 5 LEU n 1 6 ALA n 1 7 GLU n 1 8 TYR n 1 9 GLN n 1 10 ASP n 1 11 LEU n 1 12 THR n 1 13 PHE n 1 14 LEU n 1 15 THR n 1 16 LYS n 1 17 GLN n 1 18 GLU n 1 19 ILE n 1 20 LEU n 1 21 LEU n 1 22 ALA n 1 23 HIS n 1 24 ARG n 1 25 ARG n 1 26 PHE n 1 27 CYS n 1 28 GLU n 1 29 LEU n 1 30 LEU n 1 31 PRO n 1 32 GLN n 1 33 GLU n 1 34 GLN n 1 35 ARG n 1 36 SER n 1 37 VAL n 1 38 GLU n 1 39 SER n 1 40 SER n 1 41 LEU n 1 42 ARG n 1 43 ALA n 1 44 GLN n 1 45 VAL n 1 46 PRO n 1 47 PHE n 1 48 GLU n 1 49 GLN n 1 50 ILE n 1 51 LEU n 1 52 SER n 1 53 LEU n 1 54 PRO n 1 55 GLU n 1 56 LEU n 1 57 LYS n 1 58 ALA n 1 59 ASN n 1 60 PRO n 1 61 PHE n 1 62 LYS n 1 63 GLU n 1 64 ARG n 1 65 ILE n 1 66 CYS n 1 67 ARG n 1 68 VAL n 1 69 PHE n 1 70 SER n 1 71 THR n 1 72 SER n 1 73 PRO n 1 74 ALA n 1 75 LYS n 1 76 ASP n 1 77 SER n 1 78 LEU n 1 79 SER n 1 80 PHE n 1 81 GLU n 1 82 ASP n 1 83 PHE n 1 84 LEU n 1 85 ASP n 1 86 LEU n 1 87 LEU n 1 88 SER n 1 89 VAL n 1 90 PHE n 1 91 SER n 1 92 ASP n 1 93 THR n 1 94 ALA n 1 95 THR n 1 96 PRO n 1 97 ASP n 1 98 ILE n 1 99 LYS n 1 100 SER n 1 101 HIS n 1 102 TYR n 1 103 ALA n 1 104 PHE n 1 105 ARG n 1 106 ILE n 1 107 PHE n 1 108 ASP n 1 109 PHE n 1 110 ASP n 1 111 ASP n 1 112 ASP n 1 113 GLY n 1 114 THR n 1 115 LEU n 1 116 ASN n 1 117 ARG n 1 118 GLU n 1 119 ASP n 1 120 LEU n 1 121 SER n 1 122 ARG n 1 123 LEU n 1 124 VAL n 1 125 ASN n 1 126 CYS n 1 127 LEU n 1 128 THR n 1 129 GLY n 1 130 GLU n 1 131 GLY n 1 132 GLU n 1 133 ASP n 1 134 THR n 1 135 ARG n 1 136 LEU n 1 137 SER n 1 138 ALA n 1 139 SER n 1 140 GLU n 1 141 MET n 1 142 LYS n 1 143 GLN n 1 144 LEU n 1 145 ILE n 1 146 ASP n 1 147 ASN n 1 148 ILE n 1 149 LEU n 1 150 GLU n 1 151 GLU n 1 152 SER n 1 153 ASP n 1 154 ILE n 1 155 ASP n 1 156 ARG n 1 157 ASP n 1 158 GLY n 1 159 THR n 1 160 ILE n 1 161 ASN n 1 162 LEU n 1 163 SER n 1 164 GLU n 1 165 PHE n 1 166 GLN n 1 167 HIS n 1 168 VAL n 1 169 ILE n 1 170 SER n 1 171 ARG n 1 172 SER n 1 173 PRO n 1 174 ASP n 1 175 PHE n 1 176 ALA n 1 177 SER n 1 178 SER n 1 179 PHE n 1 180 LYS n 1 181 ILE n 1 182 VAL n 1 183 LEU n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name human _entity_src_nat.pdbx_organism_scientific 'Homo sapiens' _entity_src_nat.pdbx_ncbi_taxonomy_id 9606 _entity_src_nat.genus Homo _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KIP1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q99828 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1DGU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 183 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99828 _struct_ref_seq.db_align_beg 9 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 191 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 183 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1DGU _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 36 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q99828 _struct_ref_seq_dif.db_mon_id THR _struct_ref_seq_dif.pdbx_seq_db_seq_num 44 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 36 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1DGU _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _exptl.entry_id 1DGU _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1DGU _struct.title 'HOMOLOGY-BASED MODEL OF CALCIUM-SATURATED CIB (CALCIUM-AND INTEGRIN-BINDING PROTEIN)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1DGU _struct_keywords.pdbx_keywords 'BLOOD CLOTTING' _struct_keywords.text 'HELICAL, EF-HANDS, BLOOD CLOTTING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 15 ? LEU A 30 ? THR A 15 LEU A 30 1 ? 16 HELX_P HELX_P2 2 PRO A 46 ? SER A 52 ? PRO A 46 SER A 52 1 ? 7 HELX_P HELX_P3 3 PHE A 61 ? SER A 70 ? PHE A 61 SER A 70 1 ? 10 HELX_P HELX_P4 4 SER A 79 ? SER A 91 ? SER A 79 SER A 91 1 ? 13 HELX_P HELX_P5 5 THR A 95 ? ASP A 108 ? THR A 95 ASP A 108 1 ? 14 HELX_P HELX_P6 6 ARG A 117 ? GLY A 129 ? ARG A 117 GLY A 129 1 ? 13 HELX_P HELX_P7 7 THR A 134 ? ASP A 153 ? THR A 134 ASP A 153 1 ? 20 HELX_P HELX_P8 8 LEU A 162 ? SER A 170 ? LEU A 162 SER A 170 1 ? 9 HELX_P HELX_P9 9 PRO A 173 ? SER A 178 ? PRO A 173 SER A 178 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 114 ? ASN A 116 ? THR A 114 ASN A 116 A 2 THR A 159 ? ASN A 161 ? THR A 159 ASN A 161 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 115 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 115 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 160 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 160 # _database_PDB_matrix.entry_id 1DGU _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1DGU _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 CYS 126 126 126 CYS CYS A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 SER 139 139 139 SER SER A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 MET 141 141 141 MET MET A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 GLN 143 143 143 GLN GLN A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 ASN 147 147 147 ASN ASN A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 ASP 155 155 155 ASP ASP A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 THR 159 159 159 THR THR A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 GLN 166 166 166 GLN GLN A . n A 1 167 HIS 167 167 167 HIS HIS A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 ARG 171 171 171 ARG ARG A . n A 1 172 SER 172 172 172 SER SER A . n A 1 173 PRO 173 173 173 PRO PRO A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 PHE 175 175 175 PHE PHE A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 PHE 179 179 179 PHE PHE A . n A 1 180 LYS 180 180 180 LYS LYS A . n A 1 181 ILE 181 181 181 ILE ILE A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 LEU 183 183 183 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-12-08 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 3 ? ? OE2 A GLU 3 ? ? 1.362 1.252 0.110 0.011 N 2 1 CD A GLU 7 ? ? OE2 A GLU 7 ? ? 1.360 1.252 0.108 0.011 N 3 1 CD A GLU 18 ? ? OE2 A GLU 18 ? ? 1.360 1.252 0.108 0.011 N 4 1 CG A HIS 23 ? ? CD2 A HIS 23 ? ? 1.410 1.354 0.056 0.009 N 5 1 CD A GLU 28 ? ? OE2 A GLU 28 ? ? 1.360 1.252 0.108 0.011 N 6 1 CD A GLU 33 ? ? OE2 A GLU 33 ? ? 1.357 1.252 0.105 0.011 N 7 1 CD A GLU 38 ? ? OE2 A GLU 38 ? ? 1.362 1.252 0.110 0.011 N 8 1 CD A GLU 48 ? ? OE2 A GLU 48 ? ? 1.360 1.252 0.108 0.011 N 9 1 CD A GLU 55 ? ? OE2 A GLU 55 ? ? 1.360 1.252 0.108 0.011 N 10 1 CD A GLU 63 ? ? OE2 A GLU 63 ? ? 1.362 1.252 0.110 0.011 N 11 1 CD A GLU 81 ? ? OE2 A GLU 81 ? ? 1.360 1.252 0.108 0.011 N 12 1 CG A HIS 101 ? ? CD2 A HIS 101 ? ? 1.408 1.354 0.054 0.009 N 13 1 CD A GLU 118 ? ? OE2 A GLU 118 ? ? 1.361 1.252 0.109 0.011 N 14 1 CD A GLU 130 ? ? OE2 A GLU 130 ? ? 1.359 1.252 0.107 0.011 N 15 1 CD A GLU 132 ? ? OE2 A GLU 132 ? ? 1.360 1.252 0.108 0.011 N 16 1 CD A GLU 140 ? ? OE2 A GLU 140 ? ? 1.359 1.252 0.107 0.011 N 17 1 CD A GLU 150 ? ? OE2 A GLU 150 ? ? 1.363 1.252 0.111 0.011 N 18 1 CD A GLU 151 ? ? OE2 A GLU 151 ? ? 1.359 1.252 0.107 0.011 N 19 1 CD A GLU 164 ? ? OE2 A GLU 164 ? ? 1.349 1.252 0.097 0.011 N 20 1 CG A HIS 167 ? ? CD2 A HIS 167 ? ? 1.409 1.354 0.055 0.009 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 10 ? ? CG A ASP 10 ? ? OD1 A ASP 10 ? ? 124.10 118.30 5.80 0.90 N 2 1 CB A ASP 10 ? ? CG A ASP 10 ? ? OD2 A ASP 10 ? ? 111.70 118.30 -6.60 0.90 N 3 1 ND1 A HIS 23 ? ? CE1 A HIS 23 ? ? NE2 A HIS 23 ? ? 119.98 111.50 8.48 1.30 N 4 1 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 124.46 120.30 4.16 0.50 N 5 1 NE A ARG 25 ? ? CZ A ARG 25 ? ? NH1 A ARG 25 ? ? 125.49 120.30 5.19 0.50 N 6 1 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH1 A ARG 35 ? ? 124.69 120.30 4.39 0.50 N 7 1 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH2 A ARG 35 ? ? 117.25 120.30 -3.05 0.50 N 8 1 NE A ARG 42 ? ? CZ A ARG 42 ? ? NH1 A ARG 42 ? ? 124.08 120.30 3.78 0.50 N 9 1 NE A ARG 64 ? ? CZ A ARG 64 ? ? NH1 A ARG 64 ? ? 124.52 120.30 4.22 0.50 N 10 1 NE A ARG 67 ? ? CZ A ARG 67 ? ? NH1 A ARG 67 ? ? 124.55 120.30 4.25 0.50 N 11 1 NE A ARG 67 ? ? CZ A ARG 67 ? ? NH2 A ARG 67 ? ? 117.22 120.30 -3.08 0.50 N 12 1 O A SER 70 ? ? C A SER 70 ? ? N A THR 71 ? ? 109.83 122.70 -12.87 1.60 Y 13 1 CB A SER 72 ? ? CA A SER 72 ? ? C A SER 72 ? ? 122.19 110.10 12.09 1.90 N 14 1 CB A ASP 76 ? ? CG A ASP 76 ? ? OD1 A ASP 76 ? ? 123.94 118.30 5.64 0.90 N 15 1 CB A ASP 76 ? ? CG A ASP 76 ? ? OD2 A ASP 76 ? ? 112.55 118.30 -5.75 0.90 N 16 1 CB A ASP 82 ? ? CG A ASP 82 ? ? OD1 A ASP 82 ? ? 124.33 118.30 6.03 0.90 N 17 1 CB A ASP 82 ? ? CG A ASP 82 ? ? OD2 A ASP 82 ? ? 112.36 118.30 -5.94 0.90 N 18 1 CB A ASP 85 ? ? CG A ASP 85 ? ? OD1 A ASP 85 ? ? 123.74 118.30 5.44 0.90 N 19 1 CB A ASP 92 ? ? CG A ASP 92 ? ? OD1 A ASP 92 ? ? 124.39 118.30 6.09 0.90 N 20 1 CB A ASP 92 ? ? CG A ASP 92 ? ? OD2 A ASP 92 ? ? 112.09 118.30 -6.21 0.90 N 21 1 CB A ASP 97 ? ? CG A ASP 97 ? ? OD1 A ASP 97 ? ? 123.94 118.30 5.64 0.90 N 22 1 CB A ASP 97 ? ? CG A ASP 97 ? ? OD2 A ASP 97 ? ? 112.45 118.30 -5.85 0.90 N 23 1 ND1 A HIS 101 ? ? CE1 A HIS 101 ? ? NE2 A HIS 101 ? ? 120.04 111.50 8.54 1.30 N 24 1 NE A ARG 105 ? ? CZ A ARG 105 ? ? NH1 A ARG 105 ? ? 124.56 120.30 4.26 0.50 N 25 1 NE A ARG 105 ? ? CZ A ARG 105 ? ? NH2 A ARG 105 ? ? 117.19 120.30 -3.11 0.50 N 26 1 CB A ASP 108 ? ? CG A ASP 108 ? ? OD1 A ASP 108 ? ? 125.61 118.30 7.31 0.90 N 27 1 CB A ASP 108 ? ? CG A ASP 108 ? ? OD2 A ASP 108 ? ? 111.38 118.30 -6.92 0.90 N 28 1 CB A ASP 110 ? ? CG A ASP 110 ? ? OD1 A ASP 110 ? ? 124.27 118.30 5.97 0.90 N 29 1 CB A ASP 110 ? ? CG A ASP 110 ? ? OD2 A ASP 110 ? ? 112.03 118.30 -6.27 0.90 N 30 1 CB A ASP 111 ? ? CG A ASP 111 ? ? OD1 A ASP 111 ? ? 123.79 118.30 5.49 0.90 N 31 1 CB A ASP 111 ? ? CG A ASP 111 ? ? OD2 A ASP 111 ? ? 112.51 118.30 -5.79 0.90 N 32 1 CB A ASP 112 ? ? CG A ASP 112 ? ? OD1 A ASP 112 ? ? 124.77 118.30 6.47 0.90 N 33 1 CB A ASP 112 ? ? CG A ASP 112 ? ? OD2 A ASP 112 ? ? 112.36 118.30 -5.94 0.90 N 34 1 NE A ARG 117 ? ? CZ A ARG 117 ? ? NH1 A ARG 117 ? ? 124.62 120.30 4.32 0.50 N 35 1 NE A ARG 117 ? ? CZ A ARG 117 ? ? NH2 A ARG 117 ? ? 117.24 120.30 -3.06 0.50 N 36 1 NE A ARG 122 ? ? CZ A ARG 122 ? ? NH1 A ARG 122 ? ? 124.61 120.30 4.31 0.50 N 37 1 NE A ARG 135 ? ? CZ A ARG 135 ? ? NH1 A ARG 135 ? ? 124.41 120.30 4.11 0.50 N 38 1 CB A ASP 146 ? ? CG A ASP 146 ? ? OD1 A ASP 146 ? ? 124.15 118.30 5.85 0.90 N 39 1 CB A ASP 146 ? ? CG A ASP 146 ? ? OD2 A ASP 146 ? ? 112.01 118.30 -6.29 0.90 N 40 1 CB A ASP 153 ? ? CG A ASP 153 ? ? OD1 A ASP 153 ? ? 123.75 118.30 5.45 0.90 N 41 1 CB A ASP 153 ? ? CG A ASP 153 ? ? OD2 A ASP 153 ? ? 112.12 118.30 -6.18 0.90 N 42 1 NE A ARG 156 ? ? CZ A ARG 156 ? ? NH1 A ARG 156 ? ? 124.42 120.30 4.12 0.50 N 43 1 CB A ASP 157 ? ? CG A ASP 157 ? ? OD1 A ASP 157 ? ? 124.84 118.30 6.54 0.90 N 44 1 CB A ASP 157 ? ? CG A ASP 157 ? ? OD2 A ASP 157 ? ? 111.96 118.30 -6.34 0.90 N 45 1 ND1 A HIS 167 ? ? CE1 A HIS 167 ? ? NE2 A HIS 167 ? ? 120.06 111.50 8.56 1.30 N 46 1 NE A ARG 171 ? ? CZ A ARG 171 ? ? NH1 A ARG 171 ? ? 124.52 120.30 4.22 0.50 N 47 1 NE A ARG 171 ? ? CZ A ARG 171 ? ? NH2 A ARG 171 ? ? 117.25 120.30 -3.05 0.50 N 48 1 CB A ASP 174 ? ? CG A ASP 174 ? ? OD1 A ASP 174 ? ? 123.82 118.30 5.52 0.90 N 49 1 CB A ASP 174 ? ? CG A ASP 174 ? ? OD2 A ASP 174 ? ? 112.36 118.30 -5.94 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 4 ? ? -105.47 71.75 2 1 LEU A 5 ? ? -146.92 -59.40 3 1 GLN A 32 ? ? -133.74 -58.63 4 1 ALA A 43 ? ? -169.40 -59.90 5 1 PRO A 54 ? ? -26.57 -70.40 6 1 LEU A 56 ? ? -111.85 54.04 7 1 LYS A 57 ? ? -130.17 -74.71 8 1 SER A 70 ? ? -124.35 -69.06 9 1 SER A 72 ? ? 75.86 -101.94 10 1 LYS A 75 ? ? 77.81 -39.35 11 1 SER A 77 ? ? -128.39 -120.86 12 1 THR A 93 ? ? 94.07 -32.47 13 1 GLU A 130 ? ? -127.75 -68.99 14 1 GLU A 132 ? ? 63.36 67.10 15 1 ASP A 153 ? ? -70.95 38.79 16 1 ARG A 156 ? ? 105.17 -27.67 17 1 ASP A 157 ? ? -63.30 2.37 18 1 SER A 170 ? ? -150.03 60.61 19 1 PHE A 179 ? ? -140.27 56.21 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 GLN A 44 ? ? VAL A 45 ? ? 47.49 2 1 SER A 70 ? ? THR A 71 ? ? -79.29 3 1 ARG A 171 ? ? SER A 172 ? ? 140.29 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id SER _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 70 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -11.25 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id PHE _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 69 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.100 _pdbx_validate_planes.type 'SIDE CHAIN' #