data_1DMC # _entry.id 1DMC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1DMC pdb_00001dmc 10.2210/pdb1dmc/pdb WWPDB D_1000172839 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1DMD _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1DMC _pdbx_database_status.recvd_initial_deposition_date 1994-11-22 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Narula, S.S.' 1 'Brouwer, M.' 2 'Hua, Y.' 3 'Armitage, I.M.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Three-dimensional solution structure of Callinectes sapidus metallothionein-1 determined by homonuclear and heteronuclear magnetic resonance spectroscopy. ; Biochemistry 34 620 631 1995 BICHAW US 0006-2960 0033 ? 7819257 10.1021/bi00002a029 1 ;Establishment of Two Distinct Protein Domains in Blue Crab Callinectes Sapidus Metallothionein-I Through Heteronuclear (1H-113Cd) and Homonuclear (1H-1H) Correlation NMR Experiment ; Magn.Reson.Chem. 31 96 ? 1993 MRCHEG UK 0749-1581 0731 ? ? ? 2 'Three-Dimensional Structure of Human [113Cd-7] Metallothionein-2 in Solution Determined by Nuclear Magnetic Resonance Spectroscopy' J.Mol.Biol. 214 765 ? 1990 JMOBAK UK 0022-2836 0070 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Narula, S.S.' 1 ? primary 'Brouwer, M.' 2 ? primary 'Hua, Y.' 3 ? primary 'Armitage, I.M.' 4 ? 1 'Narula, S.S.' 5 ? 1 'Brouwer, M.' 6 ? 1 'Armitage, I.M.' 7 ? 2 'Messerle, B.A.' 8 ? 2 'Schaeffer, A.' 9 ? 2 'Vasak, M.' 10 ? 2 'Kaegi, J.H.R.' 11 ? 2 'Wuthrich, K.' 12 ? # _cell.entry_id 1DMC _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1DMC _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CD6 METALLOTHIONEIN-1' 3279.936 1 ? ? ? ? 2 non-polymer syn 'CADMIUM ION' 112.411 3 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SPCQKCTSGCKCATKEECSKTCTKPCSCCPK _entity_poly.pdbx_seq_one_letter_code_can SPCQKCTSGCKCATKEECSKTCTKPCSCCPK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 PRO n 1 3 CYS n 1 4 GLN n 1 5 LYS n 1 6 CYS n 1 7 THR n 1 8 SER n 1 9 GLY n 1 10 CYS n 1 11 LYS n 1 12 CYS n 1 13 ALA n 1 14 THR n 1 15 LYS n 1 16 GLU n 1 17 GLU n 1 18 CYS n 1 19 SER n 1 20 LYS n 1 21 THR n 1 22 CYS n 1 23 THR n 1 24 LYS n 1 25 PRO n 1 26 CYS n 1 27 SER n 1 28 CYS n 1 29 CYS n 1 30 PRO n 1 31 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'blue crab' _entity_src_gen.gene_src_genus Callinectes _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Callinectes sapidus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6763 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MT1_CALSI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P55949 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code MPGPCCNDKCVCQEGGCKAGCQCTSCRCSPCQKCTSGCKCATKEECSKTCTKPCSCCPK _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1DMC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P55949 _struct_ref_seq.db_align_beg 29 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 59 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 31 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 CD non-polymer . 'CADMIUM ION' ? 'Cd 2' 112.411 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 # _pdbx_nmr_ensemble.entry_id 1DMC _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1DMC _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1DMC _struct.title ;THE THREE-DIMENSIONAL SOLUTION STRUCTURE OF CALLINECTES SAPIDUS METALLOTHIONEIN-I DETERMINED BY HOMONUCLEAR AND HETERONUCLEAR MAGNETIC RESONANCE SPECTROSCOPY ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1DMC _struct_keywords.pdbx_keywords METALLOTHIONEIN _struct_keywords.text METALLOTHIONEIN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 14 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id CYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 22 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 14 _struct_conf.end_auth_comp_id CYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 22 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 3 SG ? ? ? 1_555 D CD . CD ? ? A CYS 3 A CD 106 1_555 ? ? ? ? ? ? ? 2.602 ? ? metalc2 metalc ? ? A CYS 6 SG ? ? ? 1_555 C CD . CD ? ? A CYS 6 A CD 102 1_555 ? ? ? ? ? ? ? 2.535 ? ? metalc3 metalc ? ? A CYS 6 SG ? ? ? 1_555 D CD . CD ? ? A CYS 6 A CD 106 1_555 ? ? ? ? ? ? ? 2.555 ? ? metalc4 metalc ? ? A CYS 10 SG ? ? ? 1_555 C CD . CD ? ? A CYS 10 A CD 102 1_555 ? ? ? ? ? ? ? 2.549 ? ? metalc5 metalc ? ? A CYS 12 SG ? ? ? 1_555 B CD . CD ? ? A CYS 12 A CD 101 1_555 ? ? ? ? ? ? ? 2.536 ? ? metalc6 metalc ? ? A CYS 18 SG ? ? ? 1_555 B CD . CD ? ? A CYS 18 A CD 101 1_555 ? ? ? ? ? ? ? 2.554 ? ? metalc7 metalc ? ? A CYS 22 SG ? ? ? 1_555 B CD . CD ? ? A CYS 22 A CD 101 1_555 ? ? ? ? ? ? ? 2.556 ? ? metalc8 metalc ? ? A CYS 22 SG ? ? ? 1_555 D CD . CD ? ? A CYS 22 A CD 106 1_555 ? ? ? ? ? ? ? 2.543 ? ? metalc9 metalc ? ? A CYS 26 SG ? ? ? 1_555 D CD . CD ? ? A CYS 26 A CD 106 1_555 ? ? ? ? ? ? ? 2.588 ? ? metalc10 metalc ? ? A CYS 28 SG ? ? ? 1_555 C CD . CD ? ? A CYS 28 A CD 102 1_555 ? ? ? ? ? ? ? 2.554 ? ? metalc11 metalc ? ? A CYS 29 SG ? ? ? 1_555 B CD . CD ? ? A CYS 29 A CD 101 1_555 ? ? ? ? ? ? ? 2.547 ? ? metalc12 metalc ? ? A CYS 29 SG ? ? ? 1_555 C CD . CD ? ? A CYS 29 A CD 102 1_555 ? ? ? ? ? ? ? 2.542 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CD 101 ? 6 'BINDING SITE FOR RESIDUE CD A 101' AC2 Software A CD 102 ? 5 'BINDING SITE FOR RESIDUE CD A 102' AC3 Software A CD 106 ? 5 'BINDING SITE FOR RESIDUE CD A 106' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 CYS A 12 ? CYS A 12 . ? 1_555 ? 2 AC1 6 CYS A 18 ? CYS A 18 . ? 1_555 ? 3 AC1 6 CYS A 22 ? CYS A 22 . ? 1_555 ? 4 AC1 6 CYS A 29 ? CYS A 29 . ? 1_555 ? 5 AC1 6 CD C . ? CD A 102 . ? 1_555 ? 6 AC1 6 CD D . ? CD A 106 . ? 1_555 ? 7 AC2 5 CYS A 6 ? CYS A 6 . ? 1_555 ? 8 AC2 5 CYS A 10 ? CYS A 10 . ? 1_555 ? 9 AC2 5 CYS A 28 ? CYS A 28 . ? 1_555 ? 10 AC2 5 CYS A 29 ? CYS A 29 . ? 1_555 ? 11 AC2 5 CD B . ? CD A 101 . ? 1_555 ? 12 AC3 5 CYS A 3 ? CYS A 3 . ? 1_555 ? 13 AC3 5 CYS A 6 ? CYS A 6 . ? 1_555 ? 14 AC3 5 CYS A 22 ? CYS A 22 . ? 1_555 ? 15 AC3 5 CYS A 26 ? CYS A 26 . ? 1_555 ? 16 AC3 5 CD B . ? CD A 101 . ? 1_555 ? # _database_PDB_matrix.entry_id 1DMC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1DMC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CD H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 LYS 31 31 31 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CD 1 101 101 CD CD A . C 2 CD 1 102 102 CD CD A . D 2 CD 1 106 106 CD CD A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 3 ? A CYS 3 ? 1_555 CD ? D CD . ? A CD 106 ? 1_555 SG ? A CYS 6 ? A CYS 6 ? 1_555 94.4 ? 2 SG ? A CYS 3 ? A CYS 3 ? 1_555 CD ? D CD . ? A CD 106 ? 1_555 SG ? A CYS 22 ? A CYS 22 ? 1_555 106.4 ? 3 SG ? A CYS 6 ? A CYS 6 ? 1_555 CD ? D CD . ? A CD 106 ? 1_555 SG ? A CYS 22 ? A CYS 22 ? 1_555 108.5 ? 4 SG ? A CYS 3 ? A CYS 3 ? 1_555 CD ? D CD . ? A CD 106 ? 1_555 SG ? A CYS 26 ? A CYS 26 ? 1_555 116.3 ? 5 SG ? A CYS 6 ? A CYS 6 ? 1_555 CD ? D CD . ? A CD 106 ? 1_555 SG ? A CYS 26 ? A CYS 26 ? 1_555 120.3 ? 6 SG ? A CYS 22 ? A CYS 22 ? 1_555 CD ? D CD . ? A CD 106 ? 1_555 SG ? A CYS 26 ? A CYS 26 ? 1_555 109.5 ? 7 SG ? A CYS 6 ? A CYS 6 ? 1_555 CD ? C CD . ? A CD 102 ? 1_555 SG ? A CYS 10 ? A CYS 10 ? 1_555 108.2 ? 8 SG ? A CYS 6 ? A CYS 6 ? 1_555 CD ? C CD . ? A CD 102 ? 1_555 SG ? A CYS 28 ? A CYS 28 ? 1_555 105.1 ? 9 SG ? A CYS 10 ? A CYS 10 ? 1_555 CD ? C CD . ? A CD 102 ? 1_555 SG ? A CYS 28 ? A CYS 28 ? 1_555 104.8 ? 10 SG ? A CYS 6 ? A CYS 6 ? 1_555 CD ? C CD . ? A CD 102 ? 1_555 SG ? A CYS 29 ? A CYS 29 ? 1_555 112.7 ? 11 SG ? A CYS 10 ? A CYS 10 ? 1_555 CD ? C CD . ? A CD 102 ? 1_555 SG ? A CYS 29 ? A CYS 29 ? 1_555 113.1 ? 12 SG ? A CYS 28 ? A CYS 28 ? 1_555 CD ? C CD . ? A CD 102 ? 1_555 SG ? A CYS 29 ? A CYS 29 ? 1_555 112.4 ? 13 SG ? A CYS 12 ? A CYS 12 ? 1_555 CD ? B CD . ? A CD 101 ? 1_555 SG ? A CYS 18 ? A CYS 18 ? 1_555 109.4 ? 14 SG ? A CYS 12 ? A CYS 12 ? 1_555 CD ? B CD . ? A CD 101 ? 1_555 SG ? A CYS 22 ? A CYS 22 ? 1_555 107.3 ? 15 SG ? A CYS 18 ? A CYS 18 ? 1_555 CD ? B CD . ? A CD 101 ? 1_555 SG ? A CYS 22 ? A CYS 22 ? 1_555 108.9 ? 16 SG ? A CYS 12 ? A CYS 12 ? 1_555 CD ? B CD . ? A CD 101 ? 1_555 SG ? A CYS 29 ? A CYS 29 ? 1_555 114.0 ? 17 SG ? A CYS 18 ? A CYS 18 ? 1_555 CD ? B CD . ? A CD 101 ? 1_555 SG ? A CYS 29 ? A CYS 29 ? 1_555 96.1 ? 18 SG ? A CYS 22 ? A CYS 22 ? 1_555 CD ? B CD . ? A CD 101 ? 1_555 SG ? A CYS 29 ? A CYS 29 ? 1_555 120.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-02-07 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.value' 11 4 'Structure model' '_struct_conn.pdbx_dist_value' 12 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 13 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 14 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 15 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 16 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 17 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 18 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 19 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 20 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 21 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 22 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 23 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 24 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 25 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 26 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 3 ? ? -66.70 -166.38 2 1 LYS A 5 ? ? -149.01 13.77 3 1 THR A 7 ? ? -49.47 -88.94 4 1 CYS A 26 ? ? -51.09 -163.70 5 1 CYS A 28 ? ? -150.81 -24.52 6 1 CYS A 29 ? ? -61.83 -154.56 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CADMIUM ION' _pdbx_entity_nonpoly.comp_id CD #