data_1DSV # _entry.id 1DSV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1DSV pdb_00001dsv 10.2210/pdb1dsv/pdb RCSB RCSB010335 ? ? WWPDB D_1000010335 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1DSQ _pdbx_database_related.details 'N-terminal zinc finger of the MMTV nucleocapsid protein' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1DSV _pdbx_database_status.recvd_initial_deposition_date 2000-01-08 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Klein, D.J.' 1 'Johnson, P.E.' 2 'Zollars, E.S.' 3 'De Guzman, R.N.' 4 'Summers, M.F.' 5 # _citation.id primary _citation.title ;The NMR structure of the nucleocapsid protein from the mouse mammary tumor virus reveals unusual folding of the C-terminal zinc knuckle. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 39 _citation.page_first 1604 _citation.page_last 1612 _citation.year 2000 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10677209 _citation.pdbx_database_id_DOI 10.1021/bi9922493 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Klein, D.J.' 1 ? primary 'Johnson, P.E.' 2 ? primary 'Zollars, E.S.' 3 ? primary 'De Guzman, R.N.' 4 ? primary 'Summers, M.F.' 5 ? # _cell.entry_id 1DSV _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1DSV _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'NUCLEIC ACID BINDING PROTEIN P14' 3522.127 1 ? ? 'C-TERMINAL ZINC FINGER OF NUCLEOCAPSID PROTEIN' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code PPGLCPRCKKGYHWKSECKSKFDKDGNPLPP _entity_poly.pdbx_seq_one_letter_code_can PPGLCPRCKKGYHWKSECKSKFDKDGNPLPP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 PRO n 1 3 GLY n 1 4 LEU n 1 5 CYS n 1 6 PRO n 1 7 ARG n 1 8 CYS n 1 9 LYS n 1 10 LYS n 1 11 GLY n 1 12 TYR n 1 13 HIS n 1 14 TRP n 1 15 LYS n 1 16 SER n 1 17 GLU n 1 18 CYS n 1 19 LYS n 1 20 SER n 1 21 LYS n 1 22 PHE n 1 23 ASP n 1 24 LYS n 1 25 ASP n 1 26 GLY n 1 27 ASN n 1 28 PRO n 1 29 LEU n 1 30 PRO n 1 31 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Betaretrovirus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mouse mammary tumor virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11757 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)PLYSE' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-3D _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GAG_MMTVC _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P11284 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1DSV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P11284 _struct_ref_seq.db_align_beg 550 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 580 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 54 _struct_ref_seq.pdbx_auth_seq_align_end 84 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 25 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '~50 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM unlabelled MMTV Nc, 25 mM acetate (d3), pH 7.0, 20 mM NaCl, 0.1 mM ZnCl2, 0.1 mM BME' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AVANCE 600 2 ? GE PSG 600 # _pdbx_nmr_refine.entry_id 1DSV _pdbx_nmr_refine.method ? _pdbx_nmr_refine.details ;data was collected on the intact nucleocapsid protein but the structures of the N- and C-terminal zinc fingers were calculated independently. These two domains do not interact with each other ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1DSV _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1DSV _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest target function' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DYANA 1.5 refinement guntert 1 NMRPipe 1.7 processing Delaglio 2 NMRView 3 'data analysis' Johnson 3 # _exptl.entry_id 1DSV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1DSV _struct.title 'STRUCTURE OF THE MMTV NUCLEOCAPSID PROTEIN (C-TERMINAL ZINC FINGER)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1DSV _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'CCHC type zinc finger, VIRUS/VIRAL PROTEIN, Viral protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id LYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 24 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 26 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 77 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 79 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 5 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 58 A ZN 171 1_555 ? ? ? ? ? ? ? 2.389 ? ? metalc2 metalc ? ? A CYS 8 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 61 A ZN 171 1_555 ? ? ? ? ? ? ? 2.361 ? ? metalc3 metalc ? ? A HIS 13 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 66 A ZN 171 1_555 ? ? ? ? ? ? ? 2.073 ? ? metalc4 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 71 A ZN 171 1_555 ? ? ? ? ? ? ? 2.303 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 22 ? ASP A 23 ? PHE A 75 ASP A 76 A 2 ASN A 27 ? PRO A 28 ? ASN A 80 PRO A 81 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ASP _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 23 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ASP _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 76 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ASN _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 27 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ASN _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 80 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 171 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 171' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 5 ? CYS A 58 . ? 1_555 ? 2 AC1 4 CYS A 8 ? CYS A 61 . ? 1_555 ? 3 AC1 4 HIS A 13 ? HIS A 66 . ? 1_555 ? 4 AC1 4 CYS A 18 ? CYS A 71 . ? 1_555 ? # _database_PDB_matrix.entry_id 1DSV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1DSV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 54 54 PRO PRO A . n A 1 2 PRO 2 55 55 PRO PRO A . n A 1 3 GLY 3 56 56 GLY GLY A . n A 1 4 LEU 4 57 57 LEU LEU A . n A 1 5 CYS 5 58 58 CYS CYS A . n A 1 6 PRO 6 59 59 PRO PRO A . n A 1 7 ARG 7 60 60 ARG ARG A . n A 1 8 CYS 8 61 61 CYS CYS A . n A 1 9 LYS 9 62 62 LYS LYS A . n A 1 10 LYS 10 63 63 LYS LYS A . n A 1 11 GLY 11 64 64 GLY GLY A . n A 1 12 TYR 12 65 65 TYR TYR A . n A 1 13 HIS 13 66 66 HIS HIS A . n A 1 14 TRP 14 67 67 TRP TRP A . n A 1 15 LYS 15 68 68 LYS LYS A . n A 1 16 SER 16 69 69 SER SER A . n A 1 17 GLU 17 70 70 GLU GLU A . n A 1 18 CYS 18 71 71 CYS CYS A . n A 1 19 LYS 19 72 72 LYS LYS A . n A 1 20 SER 20 73 73 SER SER A . n A 1 21 LYS 21 74 74 LYS LYS A . n A 1 22 PHE 22 75 75 PHE PHE A . n A 1 23 ASP 23 76 76 ASP ASP A . n A 1 24 LYS 24 77 77 LYS LYS A . n A 1 25 ASP 25 78 78 ASP ASP A . n A 1 26 GLY 26 79 79 GLY GLY A . n A 1 27 ASN 27 80 80 ASN ASN A . n A 1 28 PRO 28 81 81 PRO PRO A . n A 1 29 LEU 29 82 82 LEU LEU A . n A 1 30 PRO 30 83 83 PRO PRO A . n A 1 31 PRO 31 84 84 PRO PRO A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 171 _pdbx_nonpoly_scheme.auth_seq_num 71 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 5 ? A CYS 58 ? 1_555 ZN ? B ZN . ? A ZN 171 ? 1_555 SG ? A CYS 8 ? A CYS 61 ? 1_555 96.1 ? 2 SG ? A CYS 5 ? A CYS 58 ? 1_555 ZN ? B ZN . ? A ZN 171 ? 1_555 NE2 ? A HIS 13 ? A HIS 66 ? 1_555 94.9 ? 3 SG ? A CYS 8 ? A CYS 61 ? 1_555 ZN ? B ZN . ? A ZN 171 ? 1_555 NE2 ? A HIS 13 ? A HIS 66 ? 1_555 109.5 ? 4 SG ? A CYS 5 ? A CYS 58 ? 1_555 ZN ? B ZN . ? A ZN 171 ? 1_555 SG ? A CYS 18 ? A CYS 71 ? 1_555 130.0 ? 5 SG ? A CYS 8 ? A CYS 61 ? 1_555 ZN ? B ZN . ? A ZN 171 ? 1_555 SG ? A CYS 18 ? A CYS 71 ? 1_555 122.8 ? 6 NE2 ? A HIS 13 ? A HIS 66 ? 1_555 ZN ? B ZN . ? A ZN 171 ? 1_555 SG ? A CYS 18 ? A CYS 71 ? 1_555 99.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-01-28 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_spectrometer 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.value' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 28 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 29 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 30 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 58 ? ? -43.60 102.53 2 1 HIS A 66 ? ? 178.90 167.60 3 1 LYS A 77 ? ? -37.25 151.63 4 1 LEU A 82 ? ? -39.16 99.66 5 2 CYS A 58 ? ? -45.97 103.99 6 2 HIS A 66 ? ? 179.66 164.12 7 2 LYS A 77 ? ? -37.32 151.53 8 2 LEU A 82 ? ? -39.04 99.55 9 3 CYS A 58 ? ? -42.94 101.96 10 3 HIS A 66 ? ? 179.30 173.06 11 3 LYS A 77 ? ? -37.28 150.07 12 3 LEU A 82 ? ? -38.92 99.48 13 4 LEU A 57 ? ? -53.74 108.20 14 4 CYS A 58 ? ? -41.94 101.41 15 4 HIS A 66 ? ? 175.79 169.99 16 4 LYS A 77 ? ? -37.13 150.54 17 4 LEU A 82 ? ? -38.92 99.47 18 5 PRO A 55 ? ? -75.02 -72.77 19 5 CYS A 58 ? ? -43.41 102.46 20 5 HIS A 66 ? ? 177.89 174.36 21 5 LYS A 77 ? ? -36.89 153.80 22 6 CYS A 58 ? ? -49.74 105.98 23 6 ARG A 60 ? ? -90.97 -66.90 24 6 LYS A 77 ? ? -36.78 149.90 25 6 LEU A 82 ? ? -38.57 99.23 26 7 CYS A 58 ? ? -42.67 101.92 27 7 HIS A 66 ? ? 177.17 171.08 28 7 LYS A 77 ? ? -37.08 150.68 29 7 LEU A 82 ? ? -38.99 99.52 30 8 CYS A 58 ? ? -47.45 104.94 31 8 ARG A 60 ? ? -90.28 -67.54 32 8 LYS A 77 ? ? -37.10 151.25 33 8 LEU A 82 ? ? -38.77 99.41 34 9 CYS A 58 ? ? -47.21 104.60 35 9 ARG A 60 ? ? -90.64 -67.27 36 9 SER A 73 ? ? -60.25 -178.77 37 9 LYS A 77 ? ? -36.27 150.32 38 9 LEU A 82 ? ? -40.15 159.18 39 10 CYS A 58 ? ? -41.60 100.96 40 10 HIS A 66 ? ? 176.50 168.99 41 10 LYS A 77 ? ? -36.73 150.08 42 10 LEU A 82 ? ? -40.11 158.86 43 11 PRO A 55 ? ? -75.01 -168.97 44 11 CYS A 58 ? ? -50.07 106.44 45 11 ARG A 60 ? ? -90.88 -67.96 46 11 LYS A 77 ? ? -36.33 151.98 47 12 LEU A 57 ? ? -49.23 109.66 48 12 CYS A 58 ? ? -45.99 103.96 49 12 LYS A 63 ? ? -140.54 15.33 50 12 HIS A 66 ? ? 176.42 171.72 51 12 LYS A 77 ? ? -37.13 150.88 52 12 LEU A 82 ? ? -39.23 99.67 53 13 CYS A 58 ? ? -44.47 103.06 54 13 LYS A 62 ? ? 72.06 48.22 55 13 LYS A 63 ? ? -143.22 17.37 56 13 HIS A 66 ? ? 176.28 167.50 57 13 LYS A 77 ? ? -37.38 151.14 58 13 LEU A 82 ? ? -39.54 99.91 59 14 LYS A 77 ? ? -36.90 150.76 60 14 LEU A 82 ? ? -38.74 99.39 61 15 PRO A 55 ? ? -75.00 -163.46 62 15 CYS A 58 ? ? -49.30 105.65 63 15 SER A 73 ? ? -54.87 -178.87 64 15 LYS A 77 ? ? -36.59 150.11 65 15 LEU A 82 ? ? -39.77 158.29 66 16 ARG A 60 ? ? -91.45 -67.22 67 16 LYS A 77 ? ? -37.03 151.58 68 16 LEU A 82 ? ? -38.78 99.31 69 17 PRO A 55 ? ? -74.98 -82.83 70 17 LYS A 77 ? ? -36.88 150.66 71 17 LEU A 82 ? ? -38.77 99.34 72 18 PRO A 55 ? ? -74.95 -164.75 73 18 LEU A 57 ? ? -51.99 107.00 74 18 CYS A 58 ? ? -41.26 100.45 75 18 HIS A 66 ? ? 176.81 171.15 76 18 LYS A 77 ? ? -37.30 150.27 77 18 LEU A 82 ? ? -39.79 151.18 78 19 ARG A 60 ? ? -98.66 -69.61 79 19 LYS A 77 ? ? -37.05 151.47 80 19 LEU A 82 ? ? -38.83 99.41 81 20 ARG A 60 ? ? -94.22 -65.76 82 20 LYS A 77 ? ? -37.09 149.67 83 20 LEU A 82 ? ? -40.38 159.42 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #