data_1DT6 # _entry.id 1DT6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1DT6 pdb_00001dt6 10.2210/pdb1dt6/pdb RCSB RCSB010346 ? ? WWPDB D_1000010346 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1DT6 _pdbx_database_status.recvd_initial_deposition_date 2000-01-11 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Williams, P.A.' 1 'Cosme, J.' 2 'Sridhar, V.' 3 'Johnson, E.F.' 4 'McRee, D.E.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Mammalian microsomal cytochrome P450 monooxygenase: structural adaptations for membrane binding and functional diversity.' Mol.Cell 5 121 131 2000 MOCEFL US 1097-2765 2168 ? 10678174 '10.1016/S1097-2765(00)80408-6' 1 ;Engineering Microsomal Cytochrome P450 2C5 to be a Soluble, Monomeric Enzyme. Mutations that Alter Aggregation, Phospholipid Dependence of Catalysis and Membrane Binding ; J.Biol.Chem. 275 2545 2553 2000 JBCHA3 US 0021-9258 0071 ? ? 10.1074/jbc.275.4.2545 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Williams, P.A.' 1 ? primary 'Cosme, J.' 2 ? primary 'Sridhar, V.' 3 ? primary 'Johnson, E.F.' 4 ? primary 'McRee, D.E.' 5 ? 1 'Cosme, J.' 6 ? 1 'Johnson, E.F.' 7 ? # _cell.entry_id 1DT6 _cell.length_a 74.700 _cell.length_b 132.000 _cell.length_c 172.400 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1DT6 _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CYTOCHROME P450 2C5' 53884.250 1 1.14.14.1 'D2A, H24S, G25S, N202H, R206E, I207L, S209G, S210T' ;CYP2C5 WITH MEMBRANE SPANNING RESIDUES 3-21 DELETED AND A 4 RESIDUE HISTIDINE TAG AT THE C-TERMINUS CONTAINING ADDITIONAL INTERNAL MUTATIONS ; ? 2 non-polymer syn 'SAMARIUM (III) ION' 150.360 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 4 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PROGESTERONE 21-HYDROXYLASE, CYPIIC5 P450 1, P450IIC5' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAKKTSSKGKLPPGPTPFPIIGNILQIDAKDISKSLTKFSECYGPVFTVYLGMKPTVVLHGYEAVKEALVDLGEEFAGRG SVPILEKVSKGLGIAFSNAKTWKEMRRFSLMTLRNFGMGKRSIEDRIQEEARCLVEELRKTNASPCDPTFILGCAPCNVI CSVIFHNRFDYKDEEFLKLMESLHENVELLGTPWLQVYNNFPALLDYFPGIHKTLLKNADYIKNFIMEKVKEHQKLLDVN NPRDFIDCFLIKMEQENNLEFTLESLVIAVSDLFGAGTETTSTTLRYSLLLLLKHPEVAARVQEEIERVIGRHRSPCMQD RSRMPYTDAVIHEIQRFIDLLPTNLPHAVTRDVRFRNYFIPKGTDIITSLTSVLHDEKAFPNPKVFDPGHFLDESGNFKK SDYFMPFSAGKRMCVGEGLARMELFLFLTSILQNFKLQSLVEPKDLDITAVVNGFVSVPPSYQLCFIPIHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MAKKTSSKGKLPPGPTPFPIIGNILQIDAKDISKSLTKFSECYGPVFTVYLGMKPTVVLHGYEAVKEALVDLGEEFAGRG SVPILEKVSKGLGIAFSNAKTWKEMRRFSLMTLRNFGMGKRSIEDRIQEEARCLVEELRKTNASPCDPTFILGCAPCNVI CSVIFHNRFDYKDEEFLKLMESLHENVELLGTPWLQVYNNFPALLDYFPGIHKTLLKNADYIKNFIMEKVKEHQKLLDVN NPRDFIDCFLIKMEQENNLEFTLESLVIAVSDLFGAGTETTSTTLRYSLLLLLKHPEVAARVQEEIERVIGRHRSPCMQD RSRMPYTDAVIHEIQRFIDLLPTNLPHAVTRDVRFRNYFIPKGTDIITSLTSVLHDEKAFPNPKVFDPGHFLDESGNFKK SDYFMPFSAGKRMCVGEGLARMELFLFLTSILQNFKLQSLVEPKDLDITAVVNGFVSVPPSYQLCFIPIHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 LYS n 1 4 LYS n 1 5 THR n 1 6 SER n 1 7 SER n 1 8 LYS n 1 9 GLY n 1 10 LYS n 1 11 LEU n 1 12 PRO n 1 13 PRO n 1 14 GLY n 1 15 PRO n 1 16 THR n 1 17 PRO n 1 18 PHE n 1 19 PRO n 1 20 ILE n 1 21 ILE n 1 22 GLY n 1 23 ASN n 1 24 ILE n 1 25 LEU n 1 26 GLN n 1 27 ILE n 1 28 ASP n 1 29 ALA n 1 30 LYS n 1 31 ASP n 1 32 ILE n 1 33 SER n 1 34 LYS n 1 35 SER n 1 36 LEU n 1 37 THR n 1 38 LYS n 1 39 PHE n 1 40 SER n 1 41 GLU n 1 42 CYS n 1 43 TYR n 1 44 GLY n 1 45 PRO n 1 46 VAL n 1 47 PHE n 1 48 THR n 1 49 VAL n 1 50 TYR n 1 51 LEU n 1 52 GLY n 1 53 MET n 1 54 LYS n 1 55 PRO n 1 56 THR n 1 57 VAL n 1 58 VAL n 1 59 LEU n 1 60 HIS n 1 61 GLY n 1 62 TYR n 1 63 GLU n 1 64 ALA n 1 65 VAL n 1 66 LYS n 1 67 GLU n 1 68 ALA n 1 69 LEU n 1 70 VAL n 1 71 ASP n 1 72 LEU n 1 73 GLY n 1 74 GLU n 1 75 GLU n 1 76 PHE n 1 77 ALA n 1 78 GLY n 1 79 ARG n 1 80 GLY n 1 81 SER n 1 82 VAL n 1 83 PRO n 1 84 ILE n 1 85 LEU n 1 86 GLU n 1 87 LYS n 1 88 VAL n 1 89 SER n 1 90 LYS n 1 91 GLY n 1 92 LEU n 1 93 GLY n 1 94 ILE n 1 95 ALA n 1 96 PHE n 1 97 SER n 1 98 ASN n 1 99 ALA n 1 100 LYS n 1 101 THR n 1 102 TRP n 1 103 LYS n 1 104 GLU n 1 105 MET n 1 106 ARG n 1 107 ARG n 1 108 PHE n 1 109 SER n 1 110 LEU n 1 111 MET n 1 112 THR n 1 113 LEU n 1 114 ARG n 1 115 ASN n 1 116 PHE n 1 117 GLY n 1 118 MET n 1 119 GLY n 1 120 LYS n 1 121 ARG n 1 122 SER n 1 123 ILE n 1 124 GLU n 1 125 ASP n 1 126 ARG n 1 127 ILE n 1 128 GLN n 1 129 GLU n 1 130 GLU n 1 131 ALA n 1 132 ARG n 1 133 CYS n 1 134 LEU n 1 135 VAL n 1 136 GLU n 1 137 GLU n 1 138 LEU n 1 139 ARG n 1 140 LYS n 1 141 THR n 1 142 ASN n 1 143 ALA n 1 144 SER n 1 145 PRO n 1 146 CYS n 1 147 ASP n 1 148 PRO n 1 149 THR n 1 150 PHE n 1 151 ILE n 1 152 LEU n 1 153 GLY n 1 154 CYS n 1 155 ALA n 1 156 PRO n 1 157 CYS n 1 158 ASN n 1 159 VAL n 1 160 ILE n 1 161 CYS n 1 162 SER n 1 163 VAL n 1 164 ILE n 1 165 PHE n 1 166 HIS n 1 167 ASN n 1 168 ARG n 1 169 PHE n 1 170 ASP n 1 171 TYR n 1 172 LYS n 1 173 ASP n 1 174 GLU n 1 175 GLU n 1 176 PHE n 1 177 LEU n 1 178 LYS n 1 179 LEU n 1 180 MET n 1 181 GLU n 1 182 SER n 1 183 LEU n 1 184 HIS n 1 185 GLU n 1 186 ASN n 1 187 VAL n 1 188 GLU n 1 189 LEU n 1 190 LEU n 1 191 GLY n 1 192 THR n 1 193 PRO n 1 194 TRP n 1 195 LEU n 1 196 GLN n 1 197 VAL n 1 198 TYR n 1 199 ASN n 1 200 ASN n 1 201 PHE n 1 202 PRO n 1 203 ALA n 1 204 LEU n 1 205 LEU n 1 206 ASP n 1 207 TYR n 1 208 PHE n 1 209 PRO n 1 210 GLY n 1 211 ILE n 1 212 HIS n 1 213 LYS n 1 214 THR n 1 215 LEU n 1 216 LEU n 1 217 LYS n 1 218 ASN n 1 219 ALA n 1 220 ASP n 1 221 TYR n 1 222 ILE n 1 223 LYS n 1 224 ASN n 1 225 PHE n 1 226 ILE n 1 227 MET n 1 228 GLU n 1 229 LYS n 1 230 VAL n 1 231 LYS n 1 232 GLU n 1 233 HIS n 1 234 GLN n 1 235 LYS n 1 236 LEU n 1 237 LEU n 1 238 ASP n 1 239 VAL n 1 240 ASN n 1 241 ASN n 1 242 PRO n 1 243 ARG n 1 244 ASP n 1 245 PHE n 1 246 ILE n 1 247 ASP n 1 248 CYS n 1 249 PHE n 1 250 LEU n 1 251 ILE n 1 252 LYS n 1 253 MET n 1 254 GLU n 1 255 GLN n 1 256 GLU n 1 257 ASN n 1 258 ASN n 1 259 LEU n 1 260 GLU n 1 261 PHE n 1 262 THR n 1 263 LEU n 1 264 GLU n 1 265 SER n 1 266 LEU n 1 267 VAL n 1 268 ILE n 1 269 ALA n 1 270 VAL n 1 271 SER n 1 272 ASP n 1 273 LEU n 1 274 PHE n 1 275 GLY n 1 276 ALA n 1 277 GLY n 1 278 THR n 1 279 GLU n 1 280 THR n 1 281 THR n 1 282 SER n 1 283 THR n 1 284 THR n 1 285 LEU n 1 286 ARG n 1 287 TYR n 1 288 SER n 1 289 LEU n 1 290 LEU n 1 291 LEU n 1 292 LEU n 1 293 LEU n 1 294 LYS n 1 295 HIS n 1 296 PRO n 1 297 GLU n 1 298 VAL n 1 299 ALA n 1 300 ALA n 1 301 ARG n 1 302 VAL n 1 303 GLN n 1 304 GLU n 1 305 GLU n 1 306 ILE n 1 307 GLU n 1 308 ARG n 1 309 VAL n 1 310 ILE n 1 311 GLY n 1 312 ARG n 1 313 HIS n 1 314 ARG n 1 315 SER n 1 316 PRO n 1 317 CYS n 1 318 MET n 1 319 GLN n 1 320 ASP n 1 321 ARG n 1 322 SER n 1 323 ARG n 1 324 MET n 1 325 PRO n 1 326 TYR n 1 327 THR n 1 328 ASP n 1 329 ALA n 1 330 VAL n 1 331 ILE n 1 332 HIS n 1 333 GLU n 1 334 ILE n 1 335 GLN n 1 336 ARG n 1 337 PHE n 1 338 ILE n 1 339 ASP n 1 340 LEU n 1 341 LEU n 1 342 PRO n 1 343 THR n 1 344 ASN n 1 345 LEU n 1 346 PRO n 1 347 HIS n 1 348 ALA n 1 349 VAL n 1 350 THR n 1 351 ARG n 1 352 ASP n 1 353 VAL n 1 354 ARG n 1 355 PHE n 1 356 ARG n 1 357 ASN n 1 358 TYR n 1 359 PHE n 1 360 ILE n 1 361 PRO n 1 362 LYS n 1 363 GLY n 1 364 THR n 1 365 ASP n 1 366 ILE n 1 367 ILE n 1 368 THR n 1 369 SER n 1 370 LEU n 1 371 THR n 1 372 SER n 1 373 VAL n 1 374 LEU n 1 375 HIS n 1 376 ASP n 1 377 GLU n 1 378 LYS n 1 379 ALA n 1 380 PHE n 1 381 PRO n 1 382 ASN n 1 383 PRO n 1 384 LYS n 1 385 VAL n 1 386 PHE n 1 387 ASP n 1 388 PRO n 1 389 GLY n 1 390 HIS n 1 391 PHE n 1 392 LEU n 1 393 ASP n 1 394 GLU n 1 395 SER n 1 396 GLY n 1 397 ASN n 1 398 PHE n 1 399 LYS n 1 400 LYS n 1 401 SER n 1 402 ASP n 1 403 TYR n 1 404 PHE n 1 405 MET n 1 406 PRO n 1 407 PHE n 1 408 SER n 1 409 ALA n 1 410 GLY n 1 411 LYS n 1 412 ARG n 1 413 MET n 1 414 CYS n 1 415 VAL n 1 416 GLY n 1 417 GLU n 1 418 GLY n 1 419 LEU n 1 420 ALA n 1 421 ARG n 1 422 MET n 1 423 GLU n 1 424 LEU n 1 425 PHE n 1 426 LEU n 1 427 PHE n 1 428 LEU n 1 429 THR n 1 430 SER n 1 431 ILE n 1 432 LEU n 1 433 GLN n 1 434 ASN n 1 435 PHE n 1 436 LYS n 1 437 LEU n 1 438 GLN n 1 439 SER n 1 440 LEU n 1 441 VAL n 1 442 GLU n 1 443 PRO n 1 444 LYS n 1 445 ASP n 1 446 LEU n 1 447 ASP n 1 448 ILE n 1 449 THR n 1 450 ALA n 1 451 VAL n 1 452 VAL n 1 453 ASN n 1 454 GLY n 1 455 PHE n 1 456 VAL n 1 457 SER n 1 458 VAL n 1 459 PRO n 1 460 PRO n 1 461 SER n 1 462 TYR n 1 463 GLN n 1 464 LEU n 1 465 CYS n 1 466 PHE n 1 467 ILE n 1 468 PRO n 1 469 ILE n 1 470 HIS n 1 471 HIS n 1 472 HIS n 1 473 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name rabbit _entity_src_gen.gene_src_genus Oryctolagus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue LIVER _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Oryctolagus cuniculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9986 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PCW _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CP2C5_RABIT _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00179 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1DT6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 469 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00179 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 487 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 21 _struct_ref_seq.pdbx_auth_seq_align_end 487 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1DT6 MET A 1 ? UNP P00179 ? ? 'expression tag' 19 1 1 1DT6 ALA A 2 ? UNP P00179 ? ? 'expression tag' 20 2 1 1DT6 LYS A 4 ? UNP P00179 GLN 22 'engineered mutation' 22 3 1 1DT6 THR A 5 ? UNP P00179 ASN 23 'engineered mutation' 23 4 1 1DT6 SER A 7 ? UNP P00179 GLY 25 'engineered mutation' 25 5 1 1DT6 LYS A 8 ? UNP P00179 ARG 26 'engineered mutation' 26 6 1 1DT6 ARG A 79 ? UNP P00179 THR 97 'engineered mutation' 97 7 1 1DT6 HIS A 184 ? UNP P00179 ASN 202 'engineered mutation' 202 8 1 1DT6 GLU A 188 ? UNP P00179 ARG 206 'engineered mutation' 206 9 1 1DT6 LEU A 189 ? UNP P00179 ILE 207 'engineered mutation' 207 10 1 1DT6 GLY A 191 ? UNP P00179 SER 209 'engineered mutation' 209 11 1 1DT6 THR A 192 ? UNP P00179 SER 210 'engineered mutation' 210 12 1 1DT6 GLN A 234 ? UNP P00179 GLU 252 'engineered mutation' 252 13 1 1DT6 HIS A 470 ? UNP P00179 ? ? 'expression tag' 488 14 1 1DT6 HIS A 471 ? UNP P00179 ? ? 'expression tag' 489 15 1 1DT6 HIS A 472 ? UNP P00179 ? ? 'expression tag' 490 16 1 1DT6 HIS A 473 ? UNP P00179 ? ? 'expression tag' 491 17 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SM non-polymer . 'SAMARIUM (III) ION' ? 'Sm 3' 150.360 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1DT6 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 4 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.94 _exptl_crystal.density_percent_sol 68.79 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 297.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details ;2.5 M ammonium sulphate, 0.1 M sodium cacodylate, 2.4mM CYMAL-5, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 24K ; _exptl_crystal_grow.pdbx_pH_range . # loop_ _diffrn.id _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.crystal_id 1 100 ? 1 2 100 ? 1 3 100 ? 1 4 100 ? 1 # loop_ _diffrn_detector.diffrn_id _diffrn_detector.detector _diffrn_detector.type _diffrn_detector.pdbx_collection_date _diffrn_detector.details 1 'IMAGE PLATE' MARRESEARCH 1998-04-01 ? 2 'IMAGE PLATE' MARRESEARCH 1998-04-01 ? 3 'IMAGE PLATE' MARRESEARCH 1998-03-06 ? 4 'IMAGE PLATE' MARRESEARCH 1998-05-02 ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.739 1.0 2 0.849 1.0 3 1.08 1.0 4 0.97 1.0 # loop_ _diffrn_source.diffrn_id _diffrn_source.source _diffrn_source.type _diffrn_source.pdbx_synchrotron_site _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_wavelength_list 1 SYNCHROTRON 'ESRF BEAMLINE BM14' ESRF BM14 1.739 ? 2 SYNCHROTRON 'ESRF BEAMLINE BM14' ESRF BM14 0.849 ? 3 SYNCHROTRON 'SSRL BEAMLINE BL7-1' SSRL BL7-1 1.08 ? 4 SYNCHROTRON 'SSRL BEAMLINE BL9-1' SSRL BL9-1 0.97 ? # _reflns.entry_id 1DT6 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 25 _reflns.d_resolution_high 3.0 _reflns.number_obs 63981 _reflns.number_all 16332 _reflns.percent_possible_obs 97.1 _reflns.pdbx_Rmerge_I_obs 0.058 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 4.7 _reflns.B_iso_Wilson_estimate 65 _reflns.pdbx_redundancy 3.2 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 3.0 _reflns_shell.d_res_low 3.1 _reflns_shell.percent_possible_all 75.6 _reflns_shell.Rmerge_I_obs 0.318 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 3 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1DT6 _refine.ls_number_reflns_obs 16288 _refine.ls_number_reflns_all 16288 _refine.pdbx_ls_sigma_I 0 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 25.0 _refine.ls_d_res_high 3.0 _refine.ls_percent_reflns_obs 93.2 _refine.ls_R_factor_obs 0.241 _refine.ls_R_factor_all 0.241 _refine.ls_R_factor_R_work 0.238 _refine.ls_R_factor_R_free 0.313 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 809 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh and Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details 'random 5%' _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 3589 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 59 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 3648 _refine_hist.d_res_high 3.0 _refine_hist.d_res_low 25.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_angle_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.77 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1DT6 _struct.title 'STRUCTURE OF MAMMALIAN CYTOCHROME P450 2C5' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1DT6 _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'membrane protein, progesterone 21-hydroxylase, benzo(a)pyrene hydroxylase, estradiol 2-hydroxylase, P450, CYP2C5, OXIDOREDUCTASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_biol.id 1 _struct_biol.details ;The biological assembly is the monomer found in the asymmetric unit. ; _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 24 ? ASP A 28 ? ILE A 42 ASP A 46 5 ? 5 HELX_P HELX_P2 2 ASP A 31 ? GLY A 44 ? ASP A 49 GLY A 62 1 ? 14 HELX_P HELX_P3 3 GLY A 61 ? VAL A 70 ? GLY A 79 VAL A 88 1 ? 10 HELX_P HELX_P4 4 THR A 101 ? LEU A 113 ? THR A 119 LEU A 131 1 ? 13 HELX_P HELX_P5 5 SER A 122 ? LYS A 140 ? SER A 140 LYS A 158 1 ? 19 HELX_P HELX_P6 6 PHE A 150 ? PHE A 165 ? PHE A 168 PHE A 183 1 ? 16 HELX_P HELX_P7 7 ASP A 173 ? LEU A 189 ? ASP A 191 LEU A 207 1 ? 17 HELX_P HELX_P8 8 PRO A 209 ? LYS A 235 ? PRO A 227 LYS A 253 1 ? 27 HELX_P HELX_P9 9 ASP A 244 ? ILE A 251 ? ASP A 262 ILE A 269 1 ? 8 HELX_P HELX_P10 10 THR A 262 ? HIS A 295 ? THR A 280 HIS A 313 1 ? 34 HELX_P HELX_P11 11 HIS A 295 ? ILE A 310 ? HIS A 313 ILE A 328 1 ? 16 HELX_P HELX_P12 12 CYS A 317 ? ARG A 323 ? CYS A 335 ARG A 341 5 ? 7 HELX_P HELX_P13 13 MET A 324 ? ASP A 339 ? MET A 342 ASP A 357 1 ? 16 HELX_P HELX_P14 14 SER A 369 ? HIS A 375 ? SER A 387 HIS A 393 1 ? 7 HELX_P HELX_P15 15 ASP A 387 ? LEU A 392 ? ASP A 405 LEU A 410 5 ? 6 HELX_P HELX_P16 16 GLY A 416 ? ASN A 434 ? GLY A 434 ASN A 452 1 ? 19 HELX_P HELX_P17 17 GLU A 442 ? LEU A 446 ? GLU A 460 LEU A 464 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 42 SG ? ? ? 1_555 A CYS 42 SG ? ? A CYS 60 A CYS 60 3_555 ? ? ? ? ? ? ? 2.126 ? ? metalc1 metalc ? ? A GLU 181 OE2 ? ? ? 1_555 B SM . SM ? ? A GLU 199 A SM 502 1_555 ? ? ? ? ? ? ? 2.354 ? ? metalc2 metalc ? ? A GLU 181 OE1 ? ? ? 1_555 B SM . SM ? ? A GLU 199 A SM 502 1_555 ? ? ? ? ? ? ? 2.487 ? ? metalc3 metalc ? ? A GLU 181 OE1 ? ? ? 2_555 B SM . SM ? ? A GLU 199 A SM 502 1_555 ? ? ? ? ? ? ? 2.487 ? ? metalc4 metalc ? ? A GLU 181 OE2 ? ? ? 2_555 B SM . SM ? ? A GLU 199 A SM 502 1_555 ? ? ? ? ? ? ? 2.354 ? ? metalc5 metalc ? ? A GLU 185 OE1 ? ? ? 1_555 B SM . SM ? ? A GLU 203 A SM 502 1_555 ? ? ? ? ? ? ? 2.219 ? ? metalc6 metalc ? ? A GLU 185 OE2 ? ? ? 1_555 B SM . SM ? ? A GLU 203 A SM 502 1_555 ? ? ? ? ? ? ? 2.319 ? ? metalc7 metalc ? ? A GLU 185 OE1 ? ? ? 2_555 B SM . SM ? ? A GLU 203 A SM 502 1_555 ? ? ? ? ? ? ? 2.219 ? ? metalc8 metalc ? ? A GLU 185 OE2 ? ? ? 2_555 B SM . SM ? ? A GLU 203 A SM 502 1_555 ? ? ? ? ? ? ? 2.319 ? ? metalc9 metalc ? ? A CYS 414 SG ? ? ? 1_555 F HEM . FE ? ? A CYS 432 A HEM 501 1_555 ? ? ? ? ? ? ? 2.461 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PHE _struct_mon_prot_cis.label_seq_id 208 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PHE _struct_mon_prot_cis.auth_seq_id 226 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 209 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 227 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.49 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 46 ? TYR A 50 ? VAL A 64 TYR A 68 A 2 PRO A 55 ? LEU A 59 ? PRO A 73 LEU A 77 A 3 ASP A 365 ? THR A 368 ? ASP A 383 THR A 386 A 4 HIS A 347 ? ALA A 348 ? HIS A 365 ALA A 366 B 1 PHE A 435 ? GLN A 438 ? PHE A 453 GLN A 456 B 2 CYS A 465 ? PRO A 468 ? CYS A 483 PRO A 486 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 49 ? N VAL A 67 O THR A 56 ? O THR A 74 A 2 3 O PRO A 55 ? O PRO A 73 N ASP A 365 ? N ASP A 383 A 3 4 N ILE A 366 ? N ILE A 384 O HIS A 347 ? O HIS A 365 B 1 2 O GLN A 438 ? O GLN A 456 N CYS A 465 ? N CYS A 483 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SM 502 ? 4 'BINDING SITE FOR RESIDUE SM A 502' AC2 Software A SO4 503 ? 3 'BINDING SITE FOR RESIDUE SO4 A 503' AC3 Software A SO4 504 ? 3 'BINDING SITE FOR RESIDUE SO4 A 504' AC4 Software A SO4 505 ? 3 'BINDING SITE FOR RESIDUE SO4 A 505' AC5 Software A HEM 501 ? 20 'BINDING SITE FOR RESIDUE HEM A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 181 ? GLU A 199 . ? 1_555 ? 2 AC1 4 GLU A 181 ? GLU A 199 . ? 2_555 ? 3 AC1 4 GLU A 185 ? GLU A 203 . ? 2_555 ? 4 AC1 4 GLU A 185 ? GLU A 203 . ? 1_555 ? 5 AC2 3 ARG A 114 ? ARG A 132 . ? 1_555 ? 6 AC2 3 ASN A 115 ? ASN A 133 . ? 1_555 ? 7 AC2 3 LYS A 436 ? LYS A 454 . ? 8_444 ? 8 AC3 3 LYS A 120 ? LYS A 138 . ? 1_555 ? 9 AC3 3 ASN A 241 ? ASN A 259 . ? 1_555 ? 10 AC3 3 ARG A 243 ? ARG A 261 . ? 1_555 ? 11 AC4 3 ASP A 393 ? ASP A 411 . ? 1_555 ? 12 AC4 3 GLU A 394 ? GLU A 412 . ? 1_555 ? 13 AC4 3 LYS A 400 ? LYS A 418 . ? 1_555 ? 14 AC5 20 ILE A 94 ? ILE A 112 . ? 1_555 ? 15 AC5 20 ALA A 95 ? ALA A 113 . ? 1_555 ? 16 AC5 20 TRP A 102 ? TRP A 120 . ? 1_555 ? 17 AC5 20 ARG A 106 ? ARG A 124 . ? 1_555 ? 18 AC5 20 ALA A 276 ? ALA A 294 . ? 1_555 ? 19 AC5 20 GLY A 277 ? GLY A 295 . ? 1_555 ? 20 AC5 20 THR A 280 ? THR A 298 . ? 1_555 ? 21 AC5 20 THR A 281 ? THR A 299 . ? 1_555 ? 22 AC5 20 THR A 284 ? THR A 302 . ? 1_555 ? 23 AC5 20 LEU A 341 ? LEU A 359 . ? 1_555 ? 24 AC5 20 ASN A 344 ? ASN A 362 . ? 1_555 ? 25 AC5 20 LEU A 345 ? LEU A 363 . ? 1_555 ? 26 AC5 20 HIS A 347 ? HIS A 365 . ? 1_555 ? 27 AC5 20 PRO A 406 ? PRO A 424 . ? 1_555 ? 28 AC5 20 PHE A 407 ? PHE A 425 . ? 1_555 ? 29 AC5 20 SER A 408 ? SER A 426 . ? 1_555 ? 30 AC5 20 ARG A 412 ? ARG A 430 . ? 1_555 ? 31 AC5 20 CYS A 414 ? CYS A 432 . ? 1_555 ? 32 AC5 20 VAL A 415 ? VAL A 433 . ? 1_555 ? 33 AC5 20 ALA A 420 ? ALA A 438 . ? 1_555 ? # _database_PDB_matrix.entry_id 1DT6 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1DT6 _atom_sites.fract_transf_matrix[1][1] 0.013387 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007576 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005800 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S SM # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 19 ? ? ? A . n A 1 2 ALA 2 20 ? ? ? A . n A 1 3 LYS 3 21 ? ? ? A . n A 1 4 LYS 4 22 ? ? ? A . n A 1 5 THR 5 23 ? ? ? A . n A 1 6 SER 6 24 ? ? ? A . n A 1 7 SER 7 25 ? ? ? A . n A 1 8 LYS 8 26 ? ? ? A . n A 1 9 GLY 9 27 ? ? ? A . n A 1 10 LYS 10 28 ? ? ? A . n A 1 11 LEU 11 29 ? ? ? A . n A 1 12 PRO 12 30 30 PRO PRO A . n A 1 13 PRO 13 31 31 PRO PRO A . n A 1 14 GLY 14 32 32 GLY GLY A . n A 1 15 PRO 15 33 33 PRO PRO A . n A 1 16 THR 16 34 34 THR THR A . n A 1 17 PRO 17 35 35 PRO PRO A . n A 1 18 PHE 18 36 36 PHE PHE A . n A 1 19 PRO 19 37 37 PRO PRO A . n A 1 20 ILE 20 38 38 ILE ILE A . n A 1 21 ILE 21 39 39 ILE ILE A . n A 1 22 GLY 22 40 40 GLY GLY A . n A 1 23 ASN 23 41 41 ASN ASN A . n A 1 24 ILE 24 42 42 ILE ILE A . n A 1 25 LEU 25 43 43 LEU LEU A . n A 1 26 GLN 26 44 44 GLN GLN A . n A 1 27 ILE 27 45 45 ILE ILE A . n A 1 28 ASP 28 46 46 ASP ASP A . n A 1 29 ALA 29 47 47 ALA ALA A . n A 1 30 LYS 30 48 48 LYS LYS A . n A 1 31 ASP 31 49 49 ASP ASP A . n A 1 32 ILE 32 50 50 ILE ILE A . n A 1 33 SER 33 51 51 SER SER A . n A 1 34 LYS 34 52 52 LYS LYS A . n A 1 35 SER 35 53 53 SER SER A . n A 1 36 LEU 36 54 54 LEU LEU A . n A 1 37 THR 37 55 55 THR THR A . n A 1 38 LYS 38 56 56 LYS LYS A . n A 1 39 PHE 39 57 57 PHE PHE A . n A 1 40 SER 40 58 58 SER SER A . n A 1 41 GLU 41 59 59 GLU GLU A . n A 1 42 CYS 42 60 60 CYS CYS A . n A 1 43 TYR 43 61 61 TYR TYR A . n A 1 44 GLY 44 62 62 GLY GLY A . n A 1 45 PRO 45 63 63 PRO PRO A . n A 1 46 VAL 46 64 64 VAL VAL A . n A 1 47 PHE 47 65 65 PHE PHE A . n A 1 48 THR 48 66 66 THR THR A . n A 1 49 VAL 49 67 67 VAL VAL A . n A 1 50 TYR 50 68 68 TYR TYR A . n A 1 51 LEU 51 69 69 LEU LEU A . n A 1 52 GLY 52 70 70 GLY GLY A . n A 1 53 MET 53 71 71 MET MET A . n A 1 54 LYS 54 72 72 LYS LYS A . n A 1 55 PRO 55 73 73 PRO PRO A . n A 1 56 THR 56 74 74 THR THR A . n A 1 57 VAL 57 75 75 VAL VAL A . n A 1 58 VAL 58 76 76 VAL VAL A . n A 1 59 LEU 59 77 77 LEU LEU A . n A 1 60 HIS 60 78 78 HIS HIS A . n A 1 61 GLY 61 79 79 GLY GLY A . n A 1 62 TYR 62 80 80 TYR TYR A . n A 1 63 GLU 63 81 81 GLU GLU A . n A 1 64 ALA 64 82 82 ALA ALA A . n A 1 65 VAL 65 83 83 VAL VAL A . n A 1 66 LYS 66 84 84 LYS LYS A . n A 1 67 GLU 67 85 85 GLU GLU A . n A 1 68 ALA 68 86 86 ALA ALA A . n A 1 69 LEU 69 87 87 LEU LEU A . n A 1 70 VAL 70 88 88 VAL VAL A . n A 1 71 ASP 71 89 89 ASP ASP A . n A 1 72 LEU 72 90 90 LEU LEU A . n A 1 73 GLY 73 91 91 GLY GLY A . n A 1 74 GLU 74 92 92 GLU GLU A . n A 1 75 GLU 75 93 93 GLU GLU A . n A 1 76 PHE 76 94 94 PHE PHE A . n A 1 77 ALA 77 95 95 ALA ALA A . n A 1 78 GLY 78 96 96 GLY GLY A . n A 1 79 ARG 79 97 97 ARG ARG A . n A 1 80 GLY 80 98 98 GLY GLY A . n A 1 81 SER 81 99 99 SER SER A . n A 1 82 VAL 82 100 100 VAL VAL A . n A 1 83 PRO 83 101 101 PRO PRO A . n A 1 84 ILE 84 102 102 ILE ILE A . n A 1 85 LEU 85 103 103 LEU LEU A . n A 1 86 GLU 86 104 104 GLU GLU A . n A 1 87 LYS 87 105 105 LYS LYS A . n A 1 88 VAL 88 106 106 VAL VAL A . n A 1 89 SER 89 107 107 SER SER A . n A 1 90 LYS 90 108 108 LYS LYS A . n A 1 91 GLY 91 109 109 GLY GLY A . n A 1 92 LEU 92 110 110 LEU LEU A . n A 1 93 GLY 93 111 111 GLY GLY A . n A 1 94 ILE 94 112 112 ILE ILE A . n A 1 95 ALA 95 113 113 ALA ALA A . n A 1 96 PHE 96 114 114 PHE PHE A . n A 1 97 SER 97 115 115 SER SER A . n A 1 98 ASN 98 116 116 ASN ASN A . n A 1 99 ALA 99 117 117 ALA ALA A . n A 1 100 LYS 100 118 118 LYS LYS A . n A 1 101 THR 101 119 119 THR THR A . n A 1 102 TRP 102 120 120 TRP TRP A . n A 1 103 LYS 103 121 121 LYS LYS A . n A 1 104 GLU 104 122 122 GLU GLU A . n A 1 105 MET 105 123 123 MET MET A . n A 1 106 ARG 106 124 124 ARG ARG A . n A 1 107 ARG 107 125 125 ARG ARG A . n A 1 108 PHE 108 126 126 PHE PHE A . n A 1 109 SER 109 127 127 SER SER A . n A 1 110 LEU 110 128 128 LEU LEU A . n A 1 111 MET 111 129 129 MET MET A . n A 1 112 THR 112 130 130 THR THR A . n A 1 113 LEU 113 131 131 LEU LEU A . n A 1 114 ARG 114 132 132 ARG ARG A . n A 1 115 ASN 115 133 133 ASN ASN A . n A 1 116 PHE 116 134 134 PHE PHE A . n A 1 117 GLY 117 135 135 GLY GLY A . n A 1 118 MET 118 136 136 MET MET A . n A 1 119 GLY 119 137 137 GLY GLY A . n A 1 120 LYS 120 138 138 LYS LYS A . n A 1 121 ARG 121 139 139 ARG ARG A . n A 1 122 SER 122 140 140 SER SER A . n A 1 123 ILE 123 141 141 ILE ILE A . n A 1 124 GLU 124 142 142 GLU GLU A . n A 1 125 ASP 125 143 143 ASP ASP A . n A 1 126 ARG 126 144 144 ARG ARG A . n A 1 127 ILE 127 145 145 ILE ILE A . n A 1 128 GLN 128 146 146 GLN GLN A . n A 1 129 GLU 129 147 147 GLU GLU A . n A 1 130 GLU 130 148 148 GLU GLU A . n A 1 131 ALA 131 149 149 ALA ALA A . n A 1 132 ARG 132 150 150 ARG ARG A . n A 1 133 CYS 133 151 151 CYS CYS A . n A 1 134 LEU 134 152 152 LEU LEU A . n A 1 135 VAL 135 153 153 VAL VAL A . n A 1 136 GLU 136 154 154 GLU GLU A . n A 1 137 GLU 137 155 155 GLU GLU A . n A 1 138 LEU 138 156 156 LEU LEU A . n A 1 139 ARG 139 157 157 ARG ARG A . n A 1 140 LYS 140 158 158 LYS LYS A . n A 1 141 THR 141 159 159 THR THR A . n A 1 142 ASN 142 160 160 ASN ASN A . n A 1 143 ALA 143 161 161 ALA ALA A . n A 1 144 SER 144 162 162 SER SER A . n A 1 145 PRO 145 163 163 PRO PRO A . n A 1 146 CYS 146 164 164 CYS CYS A . n A 1 147 ASP 147 165 165 ASP ASP A . n A 1 148 PRO 148 166 166 PRO PRO A . n A 1 149 THR 149 167 167 THR THR A . n A 1 150 PHE 150 168 168 PHE PHE A . n A 1 151 ILE 151 169 169 ILE ILE A . n A 1 152 LEU 152 170 170 LEU LEU A . n A 1 153 GLY 153 171 171 GLY GLY A . n A 1 154 CYS 154 172 172 CYS CYS A . n A 1 155 ALA 155 173 173 ALA ALA A . n A 1 156 PRO 156 174 174 PRO PRO A . n A 1 157 CYS 157 175 175 CYS CYS A . n A 1 158 ASN 158 176 176 ASN ASN A . n A 1 159 VAL 159 177 177 VAL VAL A . n A 1 160 ILE 160 178 178 ILE ILE A . n A 1 161 CYS 161 179 179 CYS CYS A . n A 1 162 SER 162 180 180 SER SER A . n A 1 163 VAL 163 181 181 VAL VAL A . n A 1 164 ILE 164 182 182 ILE ILE A . n A 1 165 PHE 165 183 183 PHE PHE A . n A 1 166 HIS 166 184 184 HIS HIS A . n A 1 167 ASN 167 185 185 ASN ASN A . n A 1 168 ARG 168 186 186 ARG ARG A . n A 1 169 PHE 169 187 187 PHE PHE A . n A 1 170 ASP 170 188 188 ASP ASP A . n A 1 171 TYR 171 189 189 TYR TYR A . n A 1 172 LYS 172 190 190 LYS LYS A . n A 1 173 ASP 173 191 191 ASP ASP A . n A 1 174 GLU 174 192 192 GLU GLU A . n A 1 175 GLU 175 193 193 GLU GLU A . n A 1 176 PHE 176 194 194 PHE PHE A . n A 1 177 LEU 177 195 195 LEU LEU A . n A 1 178 LYS 178 196 196 LYS LYS A . n A 1 179 LEU 179 197 197 LEU LEU A . n A 1 180 MET 180 198 198 MET MET A . n A 1 181 GLU 181 199 199 GLU GLU A . n A 1 182 SER 182 200 200 SER SER A . n A 1 183 LEU 183 201 201 LEU LEU A . n A 1 184 HIS 184 202 202 HIS HIS A . n A 1 185 GLU 185 203 203 GLU GLU A . n A 1 186 ASN 186 204 204 ASN ASN A . n A 1 187 VAL 187 205 205 VAL VAL A . n A 1 188 GLU 188 206 206 GLU GLU A . n A 1 189 LEU 189 207 207 LEU LEU A . n A 1 190 LEU 190 208 208 LEU LEU A . n A 1 191 GLY 191 209 209 GLY GLY A . n A 1 192 THR 192 210 210 THR THR A . n A 1 193 PRO 193 211 211 PRO PRO A . n A 1 194 TRP 194 212 ? ? ? A . n A 1 195 LEU 195 213 ? ? ? A . n A 1 196 GLN 196 214 ? ? ? A . n A 1 197 VAL 197 215 ? ? ? A . n A 1 198 TYR 198 216 ? ? ? A . n A 1 199 ASN 199 217 ? ? ? A . n A 1 200 ASN 200 218 ? ? ? A . n A 1 201 PHE 201 219 ? ? ? A . n A 1 202 PRO 202 220 ? ? ? A . n A 1 203 ALA 203 221 ? ? ? A . n A 1 204 LEU 204 222 ? ? ? A . n A 1 205 LEU 205 223 223 LEU LEU A . n A 1 206 ASP 206 224 224 ASP ASP A . n A 1 207 TYR 207 225 225 TYR TYR A . n A 1 208 PHE 208 226 226 PHE PHE A . n A 1 209 PRO 209 227 227 PRO PRO A . n A 1 210 GLY 210 228 228 GLY GLY A . n A 1 211 ILE 211 229 229 ILE ILE A . n A 1 212 HIS 212 230 230 HIS HIS A . n A 1 213 LYS 213 231 231 LYS LYS A . n A 1 214 THR 214 232 232 THR THR A . n A 1 215 LEU 215 233 233 LEU LEU A . n A 1 216 LEU 216 234 234 LEU LEU A . n A 1 217 LYS 217 235 235 LYS LYS A . n A 1 218 ASN 218 236 236 ASN ASN A . n A 1 219 ALA 219 237 237 ALA ALA A . n A 1 220 ASP 220 238 238 ASP ASP A . n A 1 221 TYR 221 239 239 TYR TYR A . n A 1 222 ILE 222 240 240 ILE ILE A . n A 1 223 LYS 223 241 241 LYS LYS A . n A 1 224 ASN 224 242 242 ASN ASN A . n A 1 225 PHE 225 243 243 PHE PHE A . n A 1 226 ILE 226 244 244 ILE ILE A . n A 1 227 MET 227 245 245 MET MET A . n A 1 228 GLU 228 246 246 GLU GLU A . n A 1 229 LYS 229 247 247 LYS LYS A . n A 1 230 VAL 230 248 248 VAL VAL A . n A 1 231 LYS 231 249 249 LYS LYS A . n A 1 232 GLU 232 250 250 GLU GLU A . n A 1 233 HIS 233 251 251 HIS HIS A . n A 1 234 GLN 234 252 252 GLN GLN A . n A 1 235 LYS 235 253 253 LYS LYS A . n A 1 236 LEU 236 254 254 LEU LEU A . n A 1 237 LEU 237 255 255 LEU LEU A . n A 1 238 ASP 238 256 256 ASP ASP A . n A 1 239 VAL 239 257 257 VAL VAL A . n A 1 240 ASN 240 258 258 ASN ASN A . n A 1 241 ASN 241 259 259 ASN ASN A . n A 1 242 PRO 242 260 260 PRO PRO A . n A 1 243 ARG 243 261 261 ARG ARG A . n A 1 244 ASP 244 262 262 ASP ASP A . n A 1 245 PHE 245 263 263 PHE PHE A . n A 1 246 ILE 246 264 264 ILE ILE A . n A 1 247 ASP 247 265 265 ASP ASP A . n A 1 248 CYS 248 266 266 CYS CYS A . n A 1 249 PHE 249 267 267 PHE PHE A . n A 1 250 LEU 250 268 268 LEU LEU A . n A 1 251 ILE 251 269 269 ILE ILE A . n A 1 252 LYS 252 270 270 LYS LYS A . n A 1 253 MET 253 271 271 MET MET A . n A 1 254 GLU 254 272 272 GLU GLU A . n A 1 255 GLN 255 273 273 GLN GLN A . n A 1 256 GLU 256 274 274 GLU GLU A . n A 1 257 ASN 257 275 275 ASN ASN A . n A 1 258 ASN 258 276 276 ASN ASN A . n A 1 259 LEU 259 277 277 LEU LEU A . n A 1 260 GLU 260 278 278 GLU GLU A . n A 1 261 PHE 261 279 279 PHE PHE A . n A 1 262 THR 262 280 280 THR THR A . n A 1 263 LEU 263 281 281 LEU LEU A . n A 1 264 GLU 264 282 282 GLU GLU A . n A 1 265 SER 265 283 283 SER SER A . n A 1 266 LEU 266 284 284 LEU LEU A . n A 1 267 VAL 267 285 285 VAL VAL A . n A 1 268 ILE 268 286 286 ILE ILE A . n A 1 269 ALA 269 287 287 ALA ALA A . n A 1 270 VAL 270 288 288 VAL VAL A . n A 1 271 SER 271 289 289 SER SER A . n A 1 272 ASP 272 290 290 ASP ASP A . n A 1 273 LEU 273 291 291 LEU LEU A . n A 1 274 PHE 274 292 292 PHE PHE A . n A 1 275 GLY 275 293 293 GLY GLY A . n A 1 276 ALA 276 294 294 ALA ALA A . n A 1 277 GLY 277 295 295 GLY GLY A . n A 1 278 THR 278 296 296 THR THR A . n A 1 279 GLU 279 297 297 GLU GLU A . n A 1 280 THR 280 298 298 THR THR A . n A 1 281 THR 281 299 299 THR THR A . n A 1 282 SER 282 300 300 SER SER A . n A 1 283 THR 283 301 301 THR THR A . n A 1 284 THR 284 302 302 THR THR A . n A 1 285 LEU 285 303 303 LEU LEU A . n A 1 286 ARG 286 304 304 ARG ARG A . n A 1 287 TYR 287 305 305 TYR TYR A . n A 1 288 SER 288 306 306 SER SER A . n A 1 289 LEU 289 307 307 LEU LEU A . n A 1 290 LEU 290 308 308 LEU LEU A . n A 1 291 LEU 291 309 309 LEU LEU A . n A 1 292 LEU 292 310 310 LEU LEU A . n A 1 293 LEU 293 311 311 LEU LEU A . n A 1 294 LYS 294 312 312 LYS LYS A . n A 1 295 HIS 295 313 313 HIS HIS A . n A 1 296 PRO 296 314 314 PRO PRO A . n A 1 297 GLU 297 315 315 GLU GLU A . n A 1 298 VAL 298 316 316 VAL VAL A . n A 1 299 ALA 299 317 317 ALA ALA A . n A 1 300 ALA 300 318 318 ALA ALA A . n A 1 301 ARG 301 319 319 ARG ARG A . n A 1 302 VAL 302 320 320 VAL VAL A . n A 1 303 GLN 303 321 321 GLN GLN A . n A 1 304 GLU 304 322 322 GLU GLU A . n A 1 305 GLU 305 323 323 GLU GLU A . n A 1 306 ILE 306 324 324 ILE ILE A . n A 1 307 GLU 307 325 325 GLU GLU A . n A 1 308 ARG 308 326 326 ARG ARG A . n A 1 309 VAL 309 327 327 VAL VAL A . n A 1 310 ILE 310 328 328 ILE ILE A . n A 1 311 GLY 311 329 329 GLY GLY A . n A 1 312 ARG 312 330 330 ARG ARG A . n A 1 313 HIS 313 331 331 HIS HIS A . n A 1 314 ARG 314 332 332 ARG ARG A . n A 1 315 SER 315 333 333 SER SER A . n A 1 316 PRO 316 334 334 PRO PRO A . n A 1 317 CYS 317 335 335 CYS CYS A . n A 1 318 MET 318 336 336 MET MET A . n A 1 319 GLN 319 337 337 GLN GLN A . n A 1 320 ASP 320 338 338 ASP ASP A . n A 1 321 ARG 321 339 339 ARG ARG A . n A 1 322 SER 322 340 340 SER SER A . n A 1 323 ARG 323 341 341 ARG ARG A . n A 1 324 MET 324 342 342 MET MET A . n A 1 325 PRO 325 343 343 PRO PRO A . n A 1 326 TYR 326 344 344 TYR TYR A . n A 1 327 THR 327 345 345 THR THR A . n A 1 328 ASP 328 346 346 ASP ASP A . n A 1 329 ALA 329 347 347 ALA ALA A . n A 1 330 VAL 330 348 348 VAL VAL A . n A 1 331 ILE 331 349 349 ILE ILE A . n A 1 332 HIS 332 350 350 HIS HIS A . n A 1 333 GLU 333 351 351 GLU GLU A . n A 1 334 ILE 334 352 352 ILE ILE A . n A 1 335 GLN 335 353 353 GLN GLN A . n A 1 336 ARG 336 354 354 ARG ARG A . n A 1 337 PHE 337 355 355 PHE PHE A . n A 1 338 ILE 338 356 356 ILE ILE A . n A 1 339 ASP 339 357 357 ASP ASP A . n A 1 340 LEU 340 358 358 LEU LEU A . n A 1 341 LEU 341 359 359 LEU LEU A . n A 1 342 PRO 342 360 360 PRO PRO A . n A 1 343 THR 343 361 361 THR THR A . n A 1 344 ASN 344 362 362 ASN ASN A . n A 1 345 LEU 345 363 363 LEU LEU A . n A 1 346 PRO 346 364 364 PRO PRO A . n A 1 347 HIS 347 365 365 HIS HIS A . n A 1 348 ALA 348 366 366 ALA ALA A . n A 1 349 VAL 349 367 367 VAL VAL A . n A 1 350 THR 350 368 368 THR THR A . n A 1 351 ARG 351 369 369 ARG ARG A . n A 1 352 ASP 352 370 370 ASP ASP A . n A 1 353 VAL 353 371 371 VAL VAL A . n A 1 354 ARG 354 372 372 ARG ARG A . n A 1 355 PHE 355 373 373 PHE PHE A . n A 1 356 ARG 356 374 374 ARG ARG A . n A 1 357 ASN 357 375 375 ASN ASN A . n A 1 358 TYR 358 376 376 TYR TYR A . n A 1 359 PHE 359 377 377 PHE PHE A . n A 1 360 ILE 360 378 378 ILE ILE A . n A 1 361 PRO 361 379 379 PRO PRO A . n A 1 362 LYS 362 380 380 LYS LYS A . n A 1 363 GLY 363 381 381 GLY GLY A . n A 1 364 THR 364 382 382 THR THR A . n A 1 365 ASP 365 383 383 ASP ASP A . n A 1 366 ILE 366 384 384 ILE ILE A . n A 1 367 ILE 367 385 385 ILE ILE A . n A 1 368 THR 368 386 386 THR THR A . n A 1 369 SER 369 387 387 SER SER A . n A 1 370 LEU 370 388 388 LEU LEU A . n A 1 371 THR 371 389 389 THR THR A . n A 1 372 SER 372 390 390 SER SER A . n A 1 373 VAL 373 391 391 VAL VAL A . n A 1 374 LEU 374 392 392 LEU LEU A . n A 1 375 HIS 375 393 393 HIS HIS A . n A 1 376 ASP 376 394 394 ASP ASP A . n A 1 377 GLU 377 395 395 GLU GLU A . n A 1 378 LYS 378 396 396 LYS LYS A . n A 1 379 ALA 379 397 397 ALA ALA A . n A 1 380 PHE 380 398 398 PHE PHE A . n A 1 381 PRO 381 399 399 PRO PRO A . n A 1 382 ASN 382 400 400 ASN ASN A . n A 1 383 PRO 383 401 401 PRO PRO A . n A 1 384 LYS 384 402 402 LYS LYS A . n A 1 385 VAL 385 403 403 VAL VAL A . n A 1 386 PHE 386 404 404 PHE PHE A . n A 1 387 ASP 387 405 405 ASP ASP A . n A 1 388 PRO 388 406 406 PRO PRO A . n A 1 389 GLY 389 407 407 GLY GLY A . n A 1 390 HIS 390 408 408 HIS HIS A . n A 1 391 PHE 391 409 409 PHE PHE A . n A 1 392 LEU 392 410 410 LEU LEU A . n A 1 393 ASP 393 411 411 ASP ASP A . n A 1 394 GLU 394 412 412 GLU GLU A . n A 1 395 SER 395 413 413 SER SER A . n A 1 396 GLY 396 414 414 GLY GLY A . n A 1 397 ASN 397 415 415 ASN ASN A . n A 1 398 PHE 398 416 416 PHE PHE A . n A 1 399 LYS 399 417 417 LYS LYS A . n A 1 400 LYS 400 418 418 LYS LYS A . n A 1 401 SER 401 419 419 SER SER A . n A 1 402 ASP 402 420 420 ASP ASP A . n A 1 403 TYR 403 421 421 TYR TYR A . n A 1 404 PHE 404 422 422 PHE PHE A . n A 1 405 MET 405 423 423 MET MET A . n A 1 406 PRO 406 424 424 PRO PRO A . n A 1 407 PHE 407 425 425 PHE PHE A . n A 1 408 SER 408 426 426 SER SER A . n A 1 409 ALA 409 427 427 ALA ALA A . n A 1 410 GLY 410 428 428 GLY GLY A . n A 1 411 LYS 411 429 429 LYS LYS A . n A 1 412 ARG 412 430 430 ARG ARG A . n A 1 413 MET 413 431 431 MET MET A . n A 1 414 CYS 414 432 432 CYS CYS A . n A 1 415 VAL 415 433 433 VAL VAL A . n A 1 416 GLY 416 434 434 GLY GLY A . n A 1 417 GLU 417 435 435 GLU GLU A . n A 1 418 GLY 418 436 436 GLY GLY A . n A 1 419 LEU 419 437 437 LEU LEU A . n A 1 420 ALA 420 438 438 ALA ALA A . n A 1 421 ARG 421 439 439 ARG ARG A . n A 1 422 MET 422 440 440 MET MET A . n A 1 423 GLU 423 441 441 GLU GLU A . n A 1 424 LEU 424 442 442 LEU LEU A . n A 1 425 PHE 425 443 443 PHE PHE A . n A 1 426 LEU 426 444 444 LEU LEU A . n A 1 427 PHE 427 445 445 PHE PHE A . n A 1 428 LEU 428 446 446 LEU LEU A . n A 1 429 THR 429 447 447 THR THR A . n A 1 430 SER 430 448 448 SER SER A . n A 1 431 ILE 431 449 449 ILE ILE A . n A 1 432 LEU 432 450 450 LEU LEU A . n A 1 433 GLN 433 451 451 GLN GLN A . n A 1 434 ASN 434 452 452 ASN ASN A . n A 1 435 PHE 435 453 453 PHE PHE A . n A 1 436 LYS 436 454 454 LYS LYS A . n A 1 437 LEU 437 455 455 LEU LEU A . n A 1 438 GLN 438 456 456 GLN GLN A . n A 1 439 SER 439 457 457 SER SER A . n A 1 440 LEU 440 458 458 LEU LEU A . n A 1 441 VAL 441 459 459 VAL VAL A . n A 1 442 GLU 442 460 460 GLU GLU A . n A 1 443 PRO 443 461 461 PRO PRO A . n A 1 444 LYS 444 462 462 LYS LYS A . n A 1 445 ASP 445 463 463 ASP ASP A . n A 1 446 LEU 446 464 464 LEU LEU A . n A 1 447 ASP 447 465 465 ASP ASP A . n A 1 448 ILE 448 466 466 ILE ILE A . n A 1 449 THR 449 467 467 THR THR A . n A 1 450 ALA 450 468 468 ALA ALA A . n A 1 451 VAL 451 469 469 VAL VAL A . n A 1 452 VAL 452 470 470 VAL VAL A . n A 1 453 ASN 453 471 471 ASN ASN A . n A 1 454 GLY 454 472 472 GLY GLY A . n A 1 455 PHE 455 473 473 PHE PHE A . n A 1 456 VAL 456 474 474 VAL VAL A . n A 1 457 SER 457 475 475 SER SER A . n A 1 458 VAL 458 476 476 VAL VAL A . n A 1 459 PRO 459 477 477 PRO PRO A . n A 1 460 PRO 460 478 478 PRO PRO A . n A 1 461 SER 461 479 479 SER SER A . n A 1 462 TYR 462 480 480 TYR TYR A . n A 1 463 GLN 463 481 481 GLN GLN A . n A 1 464 LEU 464 482 482 LEU LEU A . n A 1 465 CYS 465 483 483 CYS CYS A . n A 1 466 PHE 466 484 484 PHE PHE A . n A 1 467 ILE 467 485 485 ILE ILE A . n A 1 468 PRO 468 486 486 PRO PRO A . n A 1 469 ILE 469 487 487 ILE ILE A . n A 1 470 HIS 470 488 488 HIS HIS A . n A 1 471 HIS 471 489 489 HIS HIS A . n A 1 472 HIS 472 490 ? ? ? A . n A 1 473 HIS 473 491 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SM 1 502 502 SM SM A . C 3 SO4 1 503 503 SO4 SO4 A . D 3 SO4 1 504 504 SO4 SO4 A . E 3 SO4 1 505 505 SO4 SO4 A . F 4 HEM 1 501 501 HEM HEM A . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PQS monomeric 1 2 software_defined_assembly PISA tetrameric 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F 2 1,2,3,4 A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 12040 ? 2 MORE -280 ? 2 'SSA (A^2)' 78710 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id SM _pdbx_struct_special_symmetry.auth_seq_id 502 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id SM _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 181 ? A GLU 199 ? 1_555 SM ? B SM . ? A SM 502 ? 1_555 OE1 ? A GLU 181 ? A GLU 199 ? 1_555 53.9 ? 2 OE2 ? A GLU 181 ? A GLU 199 ? 1_555 SM ? B SM . ? A SM 502 ? 1_555 OE1 ? A GLU 181 ? A GLU 199 ? 2_555 94.0 ? 3 OE1 ? A GLU 181 ? A GLU 199 ? 1_555 SM ? B SM . ? A SM 502 ? 1_555 OE1 ? A GLU 181 ? A GLU 199 ? 2_555 85.0 ? 4 OE2 ? A GLU 181 ? A GLU 199 ? 1_555 SM ? B SM . ? A SM 502 ? 1_555 OE2 ? A GLU 181 ? A GLU 199 ? 2_555 138.7 ? 5 OE1 ? A GLU 181 ? A GLU 199 ? 1_555 SM ? B SM . ? A SM 502 ? 1_555 OE2 ? A GLU 181 ? A GLU 199 ? 2_555 94.0 ? 6 OE1 ? A GLU 181 ? A GLU 199 ? 2_555 SM ? B SM . ? A SM 502 ? 1_555 OE2 ? A GLU 181 ? A GLU 199 ? 2_555 53.9 ? 7 OE2 ? A GLU 181 ? A GLU 199 ? 1_555 SM ? B SM . ? A SM 502 ? 1_555 OE1 ? A GLU 185 ? A GLU 203 ? 1_555 81.8 ? 8 OE1 ? A GLU 181 ? A GLU 199 ? 1_555 SM ? B SM . ? A SM 502 ? 1_555 OE1 ? A GLU 185 ? A GLU 203 ? 1_555 83.4 ? 9 OE1 ? A GLU 181 ? A GLU 199 ? 2_555 SM ? B SM . ? A SM 502 ? 1_555 OE1 ? A GLU 185 ? A GLU 203 ? 1_555 167.9 ? 10 OE2 ? A GLU 181 ? A GLU 199 ? 2_555 SM ? B SM . ? A SM 502 ? 1_555 OE1 ? A GLU 185 ? A GLU 203 ? 1_555 123.7 ? 11 OE2 ? A GLU 181 ? A GLU 199 ? 1_555 SM ? B SM . ? A SM 502 ? 1_555 OE2 ? A GLU 185 ? A GLU 203 ? 1_555 68.2 ? 12 OE1 ? A GLU 181 ? A GLU 199 ? 1_555 SM ? B SM . ? A SM 502 ? 1_555 OE2 ? A GLU 185 ? A GLU 203 ? 1_555 114.2 ? 13 OE1 ? A GLU 181 ? A GLU 199 ? 2_555 SM ? B SM . ? A SM 502 ? 1_555 OE2 ? A GLU 185 ? A GLU 203 ? 1_555 130.4 ? 14 OE2 ? A GLU 181 ? A GLU 199 ? 2_555 SM ? B SM . ? A SM 502 ? 1_555 OE2 ? A GLU 185 ? A GLU 203 ? 1_555 151.3 ? 15 OE1 ? A GLU 185 ? A GLU 203 ? 1_555 SM ? B SM . ? A SM 502 ? 1_555 OE2 ? A GLU 185 ? A GLU 203 ? 1_555 58.4 ? 16 OE2 ? A GLU 181 ? A GLU 199 ? 1_555 SM ? B SM . ? A SM 502 ? 1_555 OE1 ? A GLU 185 ? A GLU 203 ? 2_555 123.7 ? 17 OE1 ? A GLU 181 ? A GLU 199 ? 1_555 SM ? B SM . ? A SM 502 ? 1_555 OE1 ? A GLU 185 ? A GLU 203 ? 2_555 167.9 ? 18 OE1 ? A GLU 181 ? A GLU 199 ? 2_555 SM ? B SM . ? A SM 502 ? 1_555 OE1 ? A GLU 185 ? A GLU 203 ? 2_555 83.4 ? 19 OE2 ? A GLU 181 ? A GLU 199 ? 2_555 SM ? B SM . ? A SM 502 ? 1_555 OE1 ? A GLU 185 ? A GLU 203 ? 2_555 81.8 ? 20 OE1 ? A GLU 185 ? A GLU 203 ? 1_555 SM ? B SM . ? A SM 502 ? 1_555 OE1 ? A GLU 185 ? A GLU 203 ? 2_555 108.5 ? 21 OE2 ? A GLU 185 ? A GLU 203 ? 1_555 SM ? B SM . ? A SM 502 ? 1_555 OE1 ? A GLU 185 ? A GLU 203 ? 2_555 71.6 ? 22 OE2 ? A GLU 181 ? A GLU 199 ? 1_555 SM ? B SM . ? A SM 502 ? 1_555 OE2 ? A GLU 185 ? A GLU 203 ? 2_555 151.3 ? 23 OE1 ? A GLU 181 ? A GLU 199 ? 1_555 SM ? B SM . ? A SM 502 ? 1_555 OE2 ? A GLU 185 ? A GLU 203 ? 2_555 130.4 ? 24 OE1 ? A GLU 181 ? A GLU 199 ? 2_555 SM ? B SM . ? A SM 502 ? 1_555 OE2 ? A GLU 185 ? A GLU 203 ? 2_555 114.2 ? 25 OE2 ? A GLU 181 ? A GLU 199 ? 2_555 SM ? B SM . ? A SM 502 ? 1_555 OE2 ? A GLU 185 ? A GLU 203 ? 2_555 68.2 ? 26 OE1 ? A GLU 185 ? A GLU 203 ? 1_555 SM ? B SM . ? A SM 502 ? 1_555 OE2 ? A GLU 185 ? A GLU 203 ? 2_555 71.6 ? 27 OE2 ? A GLU 185 ? A GLU 203 ? 1_555 SM ? B SM . ? A SM 502 ? 1_555 OE2 ? A GLU 185 ? A GLU 203 ? 2_555 88.3 ? 28 OE1 ? A GLU 185 ? A GLU 203 ? 2_555 SM ? B SM . ? A SM 502 ? 1_555 OE2 ? A GLU 185 ? A GLU 203 ? 2_555 58.4 ? 29 SG ? A CYS 414 ? A CYS 432 ? 1_555 FE ? F HEM . ? A HEM 501 ? 1_555 NA ? F HEM . ? A HEM 501 ? 1_555 87.0 ? 30 SG ? A CYS 414 ? A CYS 432 ? 1_555 FE ? F HEM . ? A HEM 501 ? 1_555 NB ? F HEM . ? A HEM 501 ? 1_555 84.1 ? 31 NA ? F HEM . ? A HEM 501 ? 1_555 FE ? F HEM . ? A HEM 501 ? 1_555 NB ? F HEM . ? A HEM 501 ? 1_555 90.8 ? 32 SG ? A CYS 414 ? A CYS 432 ? 1_555 FE ? F HEM . ? A HEM 501 ? 1_555 NC ? F HEM . ? A HEM 501 ? 1_555 82.7 ? 33 NA ? F HEM . ? A HEM 501 ? 1_555 FE ? F HEM . ? A HEM 501 ? 1_555 NC ? F HEM . ? A HEM 501 ? 1_555 169.5 ? 34 NB ? F HEM . ? A HEM 501 ? 1_555 FE ? F HEM . ? A HEM 501 ? 1_555 NC ? F HEM . ? A HEM 501 ? 1_555 90.4 ? 35 SG ? A CYS 414 ? A CYS 432 ? 1_555 FE ? F HEM . ? A HEM 501 ? 1_555 ND ? F HEM . ? A HEM 501 ? 1_555 88.1 ? 36 NA ? F HEM . ? A HEM 501 ? 1_555 FE ? F HEM . ? A HEM 501 ? 1_555 ND ? F HEM . ? A HEM 501 ? 1_555 90.2 ? 37 NB ? F HEM . ? A HEM 501 ? 1_555 FE ? F HEM . ? A HEM 501 ? 1_555 ND ? F HEM . ? A HEM 501 ? 1_555 172.0 ? 38 NC ? F HEM . ? A HEM 501 ? 1_555 FE ? F HEM . ? A HEM 501 ? 1_555 ND ? F HEM . ? A HEM 501 ? 1_555 87.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-09-27 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-01-31 5 'Structure model' 1 4 2019-07-24 6 'Structure model' 1 5 2021-11-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Experimental preparation' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Refinement description' 7 6 'Structure model' 'Database references' 8 6 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' exptl_crystal_grow 2 5 'Structure model' software 3 6 'Structure model' database_2 4 6 'Structure model' pdbx_struct_conn_angle 5 6 'Structure model' struct_conn 6 6 'Structure model' struct_ref_seq_dif 7 6 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_exptl_crystal_grow.pdbx_details' 2 4 'Structure model' '_exptl_crystal_grow.temp' 3 5 'Structure model' '_software.classification' 4 5 'Structure model' '_software.name' 5 6 'Structure model' '_database_2.pdbx_DOI' 6 6 'Structure model' '_database_2.pdbx_database_accession' 7 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 8 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 9 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 10 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 11 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 12 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 13 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 14 6 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 15 6 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 16 6 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 17 6 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 18 6 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 19 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 20 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 21 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 22 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 23 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 24 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 25 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 26 6 'Structure model' '_pdbx_struct_conn_angle.value' 27 6 'Structure model' '_struct_conn.pdbx_dist_value' 28 6 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 29 6 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 30 6 'Structure model' '_struct_conn.ptnr1_label_asym_id' 31 6 'Structure model' '_struct_conn.ptnr1_label_atom_id' 32 6 'Structure model' '_struct_conn.ptnr1_label_comp_id' 33 6 'Structure model' '_struct_conn.ptnr1_label_seq_id' 34 6 'Structure model' '_struct_conn.ptnr1_symmetry' 35 6 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 36 6 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 37 6 'Structure model' '_struct_conn.ptnr2_label_asym_id' 38 6 'Structure model' '_struct_conn.ptnr2_label_atom_id' 39 6 'Structure model' '_struct_conn.ptnr2_label_comp_id' 40 6 'Structure model' '_struct_conn.ptnr2_label_seq_id' 41 6 'Structure model' '_struct_conn.ptnr2_symmetry' 42 6 'Structure model' '_struct_ref_seq_dif.details' 43 6 'Structure model' '_struct_site.pdbx_auth_asym_id' 44 6 'Structure model' '_struct_site.pdbx_auth_comp_id' 45 6 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement . ? 1 SCALA 'data scaling' . ? 2 XTALVIEW refinement . ? 3 DENZO 'data reduction' . ? 4 CCP4 'data scaling' '(SCALA)' ? 5 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 CD1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ILE _pdbx_validate_symm_contact.auth_seq_id_1 229 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 CD1 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ILE _pdbx_validate_symm_contact.auth_seq_id_2 229 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_555 _pdbx_validate_symm_contact.dist 1.75 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 N A ARG 330 ? ? CA A ARG 330 ? ? C A ARG 330 ? ? 93.30 111.00 -17.70 2.70 N 2 1 N A SER 419 ? ? CA A SER 419 ? ? C A SER 419 ? ? 129.77 111.00 18.77 2.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 33 ? ? -48.39 -179.75 2 1 PHE A 36 ? ? 11.03 108.29 3 1 PRO A 37 ? ? -56.44 -162.69 4 1 ILE A 38 ? ? -139.85 -32.91 5 1 ILE A 39 ? ? 125.94 90.02 6 1 ASN A 41 ? ? 170.52 158.22 7 1 LEU A 43 ? ? -58.70 -0.85 8 1 ALA A 47 ? ? -97.42 -141.44 9 1 ASP A 49 ? ? -152.03 60.14 10 1 GLU A 59 ? ? -62.96 1.97 11 1 CYS A 60 ? ? -131.51 -86.37 12 1 ALA A 86 ? ? -73.11 -73.42 13 1 LEU A 90 ? ? -103.41 52.68 14 1 PHE A 94 ? ? -94.46 39.41 15 1 ALA A 95 ? ? -111.81 58.03 16 1 ARG A 97 ? ? -153.67 -68.32 17 1 VAL A 100 ? ? -125.50 -55.65 18 1 PRO A 101 ? ? -27.40 -76.55 19 1 ILE A 102 ? ? -27.22 -26.87 20 1 LEU A 103 ? ? -101.45 68.54 21 1 VAL A 106 ? ? 33.15 32.91 22 1 PHE A 114 ? ? 73.38 122.56 23 1 SER A 115 ? ? 124.68 173.42 24 1 TRP A 120 ? ? -62.72 -86.12 25 1 LYS A 121 ? ? -29.01 -43.63 26 1 MET A 136 ? ? -153.04 49.08 27 1 LYS A 158 ? ? -58.53 -1.07 28 1 ASN A 160 ? ? 49.08 26.78 29 1 PHE A 168 ? ? -72.12 -75.47 30 1 HIS A 184 ? ? 102.93 -11.07 31 1 THR A 210 ? ? -28.42 156.83 32 1 LEU A 254 ? ? -165.65 99.71 33 1 ASN A 258 ? ? 21.28 43.84 34 1 ASP A 262 ? ? 176.15 164.37 35 1 GLU A 274 ? ? 74.22 156.52 36 1 ASN A 275 ? ? -6.63 -59.13 37 1 ASN A 276 ? ? -111.44 -71.92 38 1 LEU A 277 ? ? 91.75 -116.43 39 1 LEU A 284 ? ? -48.90 -73.69 40 1 HIS A 331 ? ? -94.95 -93.94 41 1 ARG A 332 ? ? -47.53 153.59 42 1 ASP A 357 ? ? 37.10 68.30 43 1 ASN A 362 ? ? -73.01 -142.34 44 1 THR A 368 ? ? -108.31 50.96 45 1 ARG A 369 ? ? 143.37 -148.97 46 1 ARG A 372 ? ? -103.92 63.89 47 1 ARG A 374 ? ? 50.94 -158.98 48 1 TYR A 376 ? ? -146.39 -78.41 49 1 PHE A 377 ? ? 97.19 110.91 50 1 PRO A 399 ? ? -4.19 -103.79 51 1 HIS A 408 ? ? -46.21 -16.19 52 1 GLU A 412 ? ? -61.16 37.71 53 1 SER A 413 ? ? -155.74 67.06 54 1 PHE A 416 ? ? -175.44 130.09 55 1 LYS A 417 ? ? -52.48 -169.89 56 1 LYS A 418 ? ? -170.09 -124.06 57 1 SER A 419 ? ? 87.14 137.51 58 1 ASP A 420 ? ? -167.34 -24.89 59 1 SER A 426 ? ? 73.01 -158.49 60 1 ALA A 427 ? ? -164.47 8.51 61 1 GLU A 435 ? ? -24.10 -58.83 62 1 SER A 457 ? ? -79.73 -165.77 63 1 GLU A 460 ? ? -33.55 139.77 64 1 VAL A 470 ? ? -115.73 77.50 65 1 ASN A 471 ? ? -49.39 66.31 66 1 PHE A 473 ? ? -80.28 -80.66 67 1 PRO A 478 ? ? -62.54 -167.04 68 1 HIS A 488 ? ? -174.75 131.31 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 19 ? A MET 1 2 1 Y 1 A ALA 20 ? A ALA 2 3 1 Y 1 A LYS 21 ? A LYS 3 4 1 Y 1 A LYS 22 ? A LYS 4 5 1 Y 1 A THR 23 ? A THR 5 6 1 Y 1 A SER 24 ? A SER 6 7 1 Y 1 A SER 25 ? A SER 7 8 1 Y 1 A LYS 26 ? A LYS 8 9 1 Y 1 A GLY 27 ? A GLY 9 10 1 Y 1 A LYS 28 ? A LYS 10 11 1 Y 1 A LEU 29 ? A LEU 11 12 1 Y 1 A TRP 212 ? A TRP 194 13 1 Y 1 A LEU 213 ? A LEU 195 14 1 Y 1 A GLN 214 ? A GLN 196 15 1 Y 1 A VAL 215 ? A VAL 197 16 1 Y 1 A TYR 216 ? A TYR 198 17 1 Y 1 A ASN 217 ? A ASN 199 18 1 Y 1 A ASN 218 ? A ASN 200 19 1 Y 1 A PHE 219 ? A PHE 201 20 1 Y 1 A PRO 220 ? A PRO 202 21 1 Y 1 A ALA 221 ? A ALA 203 22 1 Y 1 A LEU 222 ? A LEU 204 23 1 Y 1 A HIS 490 ? A HIS 472 24 1 Y 1 A HIS 491 ? A HIS 473 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SAMARIUM (III) ION' SM 3 'SULFATE ION' SO4 4 'PROTOPORPHYRIN IX CONTAINING FE' HEM #